(data stored in ACNUC7421 zone)

EMBL: CR954246.PE403

CR954246.PE403       Location/Qualifiers
FT   CDS             433092..433991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0419"
FT                   /product="putative enzyme with RNA-directed DNA polymerase
FT                   domain"
FT                   /function="3.2 : RNA metabolism"
FT                   /EC_number="2.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85517"
FT                   /db_xref="GOA:Q3IIF0"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF0"
FT                   /protein_id="CAI85517.1"
FT                   /translation="MAIMKRKVNWVLDLDISKFFDTVEHDWLIKFIEHRIGDKRIIRLI
FT                   RQWIKVGTVDSHGHRQQSTIGTPQGAVISPLLANIYLHYSFDLWLNKQRKYARGNVTII
FT                   RYADDAVLGFQKHQDAIDCQRALTQRLLCFGLKVHPNKTKLIRFGRFAPTQYRENPSRG
FT                   KPGTFDFLGFTHYIGKKLSGEVIVKRKTKRNRQITQLKRIKQALRKRLHDKPWETGRWL
FT                   RRVIQGHINYYGVPYNAHKIGQFVEEVKKLWLKSLRRRSQRHRMTWERFKYYVRYWLPK
FT                   PRIVHPYPEQRFYAKYPR"
     MAIMKRKVNW VLDLDISKFF DTVEHDWLIK FIEHRIGDKR IIRLIRQWIK VGTVDSHGHR        60
     QQSTIGTPQG AVISPLLANI YLHYSFDLWL NKQRKYARGN VTIIRYADDA VLGFQKHQDA       120
     IDCQRALTQR LLCFGLKVHP NKTKLIRFGR FAPTQYRENP SRGKPGTFDF LGFTHYIGKK       180
     LSGEVIVKRK TKRNRQITQL KRIKQALRKR LHDKPWETGR WLRRVIQGHI NYYGVPYNAH       240
     KIGQFVEEVK KLWLKSLRRR SQRHRMTWER FKYYVRYWLP KPRIVHPYPE QRFYAKYPR        299
//

If you have problems or comments...

PBIL Back to PBIL home page