(data stored in ACNUC7421 zone)

EMBL: CR954246.PE404

CR954246.PE404       Location/Qualifiers
FT   CDS             434045..434185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0420"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85518"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE9"
FT                   /protein_id="CAI85518.1"
FT                   /translation="MTIPTATKTPVGAGGEIQPTDAIDTLIESETVEAISYEWLFTRLW
FT                   R"
     MTIPTATKTP VGAGGEIQPT DAIDTLIESE TVEAISYEWL FTRLWR                       46
//

If you have problems or comments...

PBIL Back to PBIL home page