(data stored in ACNUC7421 zone)

EMBL: CR954246.PE405

CR954246.PE405       Location/Qualifiers
FT   CDS             complement(434383..435537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0421"
FT                   /product="conserved protein of unknown function ; putative
FT                   phage integrase"
FT                   /function="4.4 : Phage-related functions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85519"
FT                   /db_xref="GOA:Q3IIE8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR022000"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE8"
FT                   /protein_id="CAI85519.1"
FT                   /translation="MAHIRIRPNGRIQFDLHIYGQRFREGTKLMATPVNIKKANATLKK
FT                   INAEIDLDTFQYRDYFPESKKVAKFEALQRAKDPDRLYPFFNDYANEWFDRQKAKWKSS
FT                   YQSVVRNTLDRYLIPEFGNILVNEIKLANVDYFRESLMVCDTKGARKLSNKRINGILWP
FT                   FVAILSLAAEEHEFTYPLRRYKTLKEERANSLPLTADEVQRFLECTPTQWRDYFTVRFW
FT                   TGMRSCEIHGLRWEDIDFNHRLIRIRHNWVNGELGDVKTPKSRRDLKMCNTLFSLFKRL
FT                   QKQTTSEFVFTHKGKPLDTHFVSTQLWYPTLNKAGLARRRPYETRHTAAVLHIAAHENP
FT                   LYISHMLGHSDTRLLFDVYAPYVANASRQDGFAFNEMMIERGIA"
     MAHIRIRPNG RIQFDLHIYG QRFREGTKLM ATPVNIKKAN ATLKKINAEI DLDTFQYRDY        60
     FPESKKVAKF EALQRAKDPD RLYPFFNDYA NEWFDRQKAK WKSSYQSVVR NTLDRYLIPE       120
     FGNILVNEIK LANVDYFRES LMVCDTKGAR KLSNKRINGI LWPFVAILSL AAEEHEFTYP       180
     LRRYKTLKEE RANSLPLTAD EVQRFLECTP TQWRDYFTVR FWTGMRSCEI HGLRWEDIDF       240
     NHRLIRIRHN WVNGELGDVK TPKSRRDLKM CNTLFSLFKR LQKQTTSEFV FTHKGKPLDT       300
     HFVSTQLWYP TLNKAGLARR RPYETRHTAA VLHIAAHENP LYISHMLGHS DTRLLFDVYA       360
     PYVANASRQD GFAFNEMMIE RGIA                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page