(data stored in ACNUC7421 zone)

EMBL: CR954246.PE406

CR954246.PE406       Location/Qualifiers
FT   CDS             complement(435971..437257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0422"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85520"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE7"
FT                   /protein_id="CAI85520.1"
FT                   /translation="MKIIIPKEKKQLLKNTTIHIDTSYSDSLATVLTNKKERSLTLVTG
FT                   QKPLFAHCVFILDKGSTNLKDKQFSIDGSYAKQLPHYFTSEQDIELNFQASSADSSFIE
FT                   LIQTDLKDNEATLRRCECSDASKEHLTYLKDNKQLPTTTVSKAVIERVIFESTGHMPYQ
FT                   FIELDSDKQHIRVQRDGKVEKKYLPKDIKLPVSIVMTQEITYKLFDFCKTINGDKIEMV
FT                   QQGELLTFKTDESSVTSTLTGLNEFYTKTPEKTETLRFVELDFYEFKAELRHCFKEYGV
FT                   IKKANDALLYLSDKKAAIAVFTEPYKFVHPFTVSKIDNKKDNVNSIFRFSPKDLLNIKI
FT                   KDLIGAKSTRLEVIEYSNGEIKLGVYYSLEDKLPYLSIPIEKDKSQLPKVLAMLESLDK
FT                   NQHKTQHKKQEIQGDLFGSDMGEGEEDEY"
     MKIIIPKEKK QLLKNTTIHI DTSYSDSLAT VLTNKKERSL TLVTGQKPLF AHCVFILDKG        60
     STNLKDKQFS IDGSYAKQLP HYFTSEQDIE LNFQASSADS SFIELIQTDL KDNEATLRRC       120
     ECSDASKEHL TYLKDNKQLP TTTVSKAVIE RVIFESTGHM PYQFIELDSD KQHIRVQRDG       180
     KVEKKYLPKD IKLPVSIVMT QEITYKLFDF CKTINGDKIE MVQQGELLTF KTDESSVTST       240
     LTGLNEFYTK TPEKTETLRF VELDFYEFKA ELRHCFKEYG VIKKANDALL YLSDKKAAIA       300
     VFTEPYKFVH PFTVSKIDNK KDNVNSIFRF SPKDLLNIKI KDLIGAKSTR LEVIEYSNGE       360
     IKLGVYYSLE DKLPYLSIPI EKDKSQLPKV LAMLESLDKN QHKTQHKKQE IQGDLFGSDM       420
     GEGEEDEY                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page