(data stored in ACNUC7421 zone)

EMBL: CR954246.PE407

CR954246.PE407       Location/Qualifiers
FT   CDS             complement(437254..440052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0423"
FT                   /product="putative orphan protein ; putative phage
FT                   integrase family"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85521"
FT                   /db_xref="GOA:Q3IIE6"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE6"
FT                   /protein_id="CAI85521.1"
FT                   /translation="MSKQFIEKQANKINDYLVHTWPHSTAQEAILWILNNLPVVSTQTP
FT                   SLDHSELSIINKKIDTIPTGNQRVYRKALDGVLFYLGNECQWQLPEKIEEKIIDADHEY
FT                   FDDLTKGTAHAQQIFTRYQQRKVLFFTTRPPLTPCFTALMIGFEIAPLSLVHICAILNN
FT                   TDSITDEVSNPRLAITHFECGTDKPQVTHYHLPIICYRLLRDYYAQYPEKITVTRLYNH
FT                   LAQWLEERGLSGVKQGEWPRRFQISWYTRFKLPPIFIKDLAYPERHVGIPCDINPSTIK
FT                   AEDIYAIDWDTKWFDSLKKSRTKIHWPHEILLKHSENPNAVEPPSWDAANILPRLLFNY
FT                   TKQLIVFGGVKKANLALDSIKNYTSLKSKLELFPLSYADAINEEAVNKWAETVYDSIDS
FT                   DIVKVTFYNFLRFLKHQEQTDTLDLSLFSSPLIPPSVSPARLGVDECDLLIKTLIESES
FT                   NHPFRSLFCIVAALLGFYAMLRRGEVLRLRRKDIRFKPSTGLITIIVTNTPEGNTKSNT
FT                   TRKVYTTLPKQYHPLFKSLFKIKKRNIDREQPLLGFKGEMYHSRQLYYLLPVSRALRFL
FT                   FGAHLNFHHLRHSGVHLFMLQTLHCLNNTPNEQRGEIPLEQEVLSSTSVATRFNYWFEG
FT                   REVDEVNDAAFLDEMGKQIGHIYYGTTRWSYLHDIDWLLPIISRAHSPYTGREYTHSEL
FT                   RYLFGLKPDSNDLSRILLKLSPKYANKNLGQKRSQPIMLRDCKLREAVFGKAIQSKHTP
FT                   LTVDHNLDWQKSIHNSEHSLLGFIFKAMLKSKTLDLYALSFIWGNGNKHHIQPISKKQH
FT                   TALNNLPPIVLSDDKQSLQITLACNSKNARAFSSVFRQADWGWLNIKFILSVNRKINSE
FT                   RQVMLLKTLFVQKNEVIQIAKHLRGKTQLTIYLIPKKTLPSNVLKFVQSFIQLFQYYEA
FT                   KQ"
     MSKQFIEKQA NKINDYLVHT WPHSTAQEAI LWILNNLPVV STQTPSLDHS ELSIINKKID        60
     TIPTGNQRVY RKALDGVLFY LGNECQWQLP EKIEEKIIDA DHEYFDDLTK GTAHAQQIFT       120
     RYQQRKVLFF TTRPPLTPCF TALMIGFEIA PLSLVHICAI LNNTDSITDE VSNPRLAITH       180
     FECGTDKPQV THYHLPIICY RLLRDYYAQY PEKITVTRLY NHLAQWLEER GLSGVKQGEW       240
     PRRFQISWYT RFKLPPIFIK DLAYPERHVG IPCDINPSTI KAEDIYAIDW DTKWFDSLKK       300
     SRTKIHWPHE ILLKHSENPN AVEPPSWDAA NILPRLLFNY TKQLIVFGGV KKANLALDSI       360
     KNYTSLKSKL ELFPLSYADA INEEAVNKWA ETVYDSIDSD IVKVTFYNFL RFLKHQEQTD       420
     TLDLSLFSSP LIPPSVSPAR LGVDECDLLI KTLIESESNH PFRSLFCIVA ALLGFYAMLR       480
     RGEVLRLRRK DIRFKPSTGL ITIIVTNTPE GNTKSNTTRK VYTTLPKQYH PLFKSLFKIK       540
     KRNIDREQPL LGFKGEMYHS RQLYYLLPVS RALRFLFGAH LNFHHLRHSG VHLFMLQTLH       600
     CLNNTPNEQR GEIPLEQEVL SSTSVATRFN YWFEGREVDE VNDAAFLDEM GKQIGHIYYG       660
     TTRWSYLHDI DWLLPIISRA HSPYTGREYT HSELRYLFGL KPDSNDLSRI LLKLSPKYAN       720
     KNLGQKRSQP IMLRDCKLRE AVFGKAIQSK HTPLTVDHNL DWQKSIHNSE HSLLGFIFKA       780
     MLKSKTLDLY ALSFIWGNGN KHHIQPISKK QHTALNNLPP IVLSDDKQSL QITLACNSKN       840
     ARAFSSVFRQ ADWGWLNIKF ILSVNRKINS ERQVMLLKTL FVQKNEVIQI AKHLRGKTQL       900
     TIYLIPKKTL PSNVLKFVQS FIQLFQYYEA KQ                                     932
//

If you have problems or comments...

PBIL Back to PBIL home page