(data stored in ACNUC7421 zone)

EMBL: CR954246.PE408

CR954246.PE408       Location/Qualifiers
FT   CDS             complement(440045..441622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0424"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85522"
FT                   /db_xref="GOA:Q3IEH6"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH6"
FT                   /protein_id="CAI85522.1"
FT                   /translation="MSISKHIARSNRLKNAGGCYPDALPYATTLAILLAKLAKVDVKTR
FT                   PAITVVALFMWLTEDWRIIDKPDDIPDFIRISGASPCRQYAFRNYYDSTVSWTEYARAC
FT                   KDKNKTTYLWQPIPTYLNQFFQTFISEKTYDTPFLTQKAKTILFELMSKAWKTPHKLQG
FT                   QPRVRKDSLQNYFIKCAQADNTLGAIVRVQLIADQQAHHRSARYYQQQSSDRIRRKIFD
FT                   AHNRYLSRLIAAARNAKINSYFVVYLKSYSVSLIKDNHEKAKYLSIPGIIKQFELDTSQ
FT                   NGESKVCTPAIMLGSRRSLDDKNVSLFFQSLQKEVEDAKESIYVKCSSQKSSSANHAAL
FT                   RDYYNKATYRIALLFIVLTGARPTHSISILSDYYSGSDITFIKDKGVLRQLILCDYLQQ
FT                   EIKHYLSLQTVIRSQLNIHTELDELWYTCNEKNIPIALTCRELRLFMHKLWPGVVPYHL
FT                   RHFYCHCANSHMFSDKLFDNDIDRLMGHENLGERLGSDILSPRRFALMKDYLNMLSQRI
FT                   GLEALIHV"
     MSISKHIARS NRLKNAGGCY PDALPYATTL AILLAKLAKV DVKTRPAITV VALFMWLTED        60
     WRIIDKPDDI PDFIRISGAS PCRQYAFRNY YDSTVSWTEY ARACKDKNKT TYLWQPIPTY       120
     LNQFFQTFIS EKTYDTPFLT QKAKTILFEL MSKAWKTPHK LQGQPRVRKD SLQNYFIKCA       180
     QADNTLGAIV RVQLIADQQA HHRSARYYQQ QSSDRIRRKI FDAHNRYLSR LIAAARNAKI       240
     NSYFVVYLKS YSVSLIKDNH EKAKYLSIPG IIKQFELDTS QNGESKVCTP AIMLGSRRSL       300
     DDKNVSLFFQ SLQKEVEDAK ESIYVKCSSQ KSSSANHAAL RDYYNKATYR IALLFIVLTG       360
     ARPTHSISIL SDYYSGSDIT FIKDKGVLRQ LILCDYLQQE IKHYLSLQTV IRSQLNIHTE       420
     LDELWYTCNE KNIPIALTCR ELRLFMHKLW PGVVPYHLRH FYCHCANSHM FSDKLFDNDI       480
     DRLMGHENLG ERLGSDILSP RRFALMKDYL NMLSQRIGLE ALIHV                       525
//

If you have problems or comments...

PBIL Back to PBIL home page