(data stored in ACNUC7421 zone)

EMBL: CR954246.PE409

CR954246.PE409       Location/Qualifiers
FT   CDS             complement(441636..442109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0425"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH5"
FT                   /protein_id="CAI85523.1"
FT                   /translation="MRYKQKSIPFDNAKLQVHPLLVTLTKNDVTQLKVNQCIGELPIEV
FT                   IQTLLDLNPLPVALSTDDDCYLTLAPSGILERFKAHPLSKKLSLKLYVYPTDAIEHVLS
FT                   VTLLYNYAVTLYLKNGFSTNIQRRLSCFKEHGIHAPKKTILANLANTSPSIFR"
     MRYKQKSIPF DNAKLQVHPL LVTLTKNDVT QLKVNQCIGE LPIEVIQTLL DLNPLPVALS        60
     TDDDCYLTLA PSGILERFKA HPLSKKLSLK LYVYPTDAIE HVLSVTLLYN YAVTLYLKNG       120
     FSTNIQRRLS CFKEHGIHAP KKTILANLAN TSPSIFR                                157
//

If you have problems or comments...

PBIL Back to PBIL home page