(data stored in ACNUC7421 zone)

EMBL: CR954246.PE410

CR954246.PE410       Location/Qualifiers
FT   CDS             443258..444010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0426"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85524"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH4"
FT                   /protein_id="CAI85524.1"
FT                   /translation="MSTLKSSNRIAFSTLNYPLDKKENRSINVANSMLYQIKKLGITIK
FT                   DEKFLLSFTKSLNEVERDPSAPHLCFDHDPRRTAQFLQRLKINLSESGQNFSLSKLGYL
FT                   LALTLGFDKYDGLLKQLDAYQCFIKKPWYIYGKKITKPLIRHNGKDTYIFLPLMSISPS
FT                   SRYMTQDMSVSIILASDLKTIGCPIIFSYRKESHGCEFRSFGTTQEDAMAWLIVHAIHQ
FT                   LQDVRLWNVELNYHRATARYEAEKEKFE"
     MSTLKSSNRI AFSTLNYPLD KKENRSINVA NSMLYQIKKL GITIKDEKFL LSFTKSLNEV        60
     ERDPSAPHLC FDHDPRRTAQ FLQRLKINLS ESGQNFSLSK LGYLLALTLG FDKYDGLLKQ       120
     LDAYQCFIKK PWYIYGKKIT KPLIRHNGKD TYIFLPLMSI SPSSRYMTQD MSVSIILASD       180
     LKTIGCPIIF SYRKESHGCE FRSFGTTQED AMAWLIVHAI HQLQDVRLWN VELNYHRATA       240
     RYEAEKEKFE                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page