(data stored in ACNUC7421 zone)

EMBL: CR954246.PE411

CR954246.PE411       Location/Qualifiers
FT   CDS             complement(444374..445306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0427"
FT                   /product="putative transcriptional activator for lysine
FT                   biosynthesis (LysR family)"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 6350602; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85525"
FT                   /db_xref="GOA:Q3IEH3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH3"
FT                   /protein_id="CAI85525.1"
FT                   /translation="MQQNQQKITLNSLEAFDAVIKTGSATGAAKLLGLTQPGISRLIAQ
FT                   LESKVGFSLFYREKARLFPTDEAVALHKQVETSLASVYRVEQLAKNIHQSHVGHLNIVA
FT                   PSSFVAGPLAEAVASFLKDHPNVKINLDSHSPARACELVANKAFDCGFIQLPENHDNLL
FT                   CEPIISSNLVCAVSSSHPFASARELQPEDLRDESLVLLGQGRHSRRRIEHAFLQSNVRL
FT                   KVRVETHTVPTACTLAKHGVGISIVNKLIAQQFQNDDLKLIPFKPEIEIVYGFITSTSA
FT                   PMNRLTQTFYNHCKVHFSQFMDSCGLSEK"
     MQQNQQKITL NSLEAFDAVI KTGSATGAAK LLGLTQPGIS RLIAQLESKV GFSLFYREKA        60
     RLFPTDEAVA LHKQVETSLA SVYRVEQLAK NIHQSHVGHL NIVAPSSFVA GPLAEAVASF       120
     LKDHPNVKIN LDSHSPARAC ELVANKAFDC GFIQLPENHD NLLCEPIISS NLVCAVSSSH       180
     PFASARELQP EDLRDESLVL LGQGRHSRRR IEHAFLQSNV RLKVRVETHT VPTACTLAKH       240
     GVGISIVNKL IAQQFQNDDL KLIPFKPEIE IVYGFITSTS APMNRLTQTF YNHCKVHFSQ       300
     FMDSCGLSEK                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page