(data stored in ACNUC7421 zone)

EMBL: CR954246.PE412

CR954246.PE412       Location/Qualifiers
FT   CDS             445425..448136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0428"
FT                   /product="putative TonB-dependent receptor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85526"
FT                   /db_xref="GOA:Q3IEH2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH2"
FT                   /protein_id="CAI85526.1"
FT                   /translation="MERLMFKQSVISLAIATACLTASHTVSAEDVTAEKSVERIAVTGS
FT                   RIKRQSATASPIQNIDLETLNANGSLSLGDALQELPSVGSSLNGNGSAGSSHGSSSLNL
FT                   RNLGANRSLVLVNGHRWVNGAGSRGFRDFVDMNTIPQAIIKRVEVLQDGATAIYGADAI
FT                   AGVVNLYTYDDYEGLEVKTTYGETTKSDRETFNIDILSGVNINDGNLMFAASHVDQKPI
FT                   YTQDRNITAVPLNGLTSATPEGHFFEDNLATVNGLTPSSGGITRDPGKDGNNIDNWRKV
FT                   NSDDTYNRYYNNYVTGPSERSSLYTQLVMPIGSVNFKAEALYNSRESDQQFSPALSPIR
FT                   GSRGFVIADDARVNPFGVEFSGSDFKHNAFFMNNGYRVNEQKVETTRFAIGLDGELSND
FT                   WSWDSFASWASNKGEFTSNNQMNLDKLALGLRACDTTGIDADVTDLVSGCVPVNIFAPL
FT                   TDDMVNYINFTGHDKNEASQLDFTANITGSLYELPAGYIGAAFGIEYRKEKGEDTPDSI
FT                   INSDPRINTYRTTTSSPREGTIGEYDLKEAYAEFSIPLLDDKPLAEYLELSLAVRYSDY
FT                   STFGSTTNSKVGLLYTPFEQLTLRANWAEGFRAPSILELFEGERLTYKAVNDPCSTDNN
FT                   LAGCSGVPTDYSQPFSNVQVTTGGNRQLVPETSKNKTVGLIYESNLIENLSFTLDWYEI
FT                   EINNTISEFGAQNNLDLCAYQNKNCDTITRDSSGEIIDILDGPVNLNATRVSGIDFVSY
FT                   YTLQTDFGDWSFNANVSKLNTLTEYSTLSDGSIEQEDLVGTAASRESYPEWRGTFSSTW
FT                   KYNGWTANYNLRHIDSTTEQFLGEPRGIGSVTYHNISGGYQFANNLSVKLGVNNLGDKQ
FT                   PPASLTNLNINFDQNTYNPVGRYMYLQLTYSL"
     MERLMFKQSV ISLAIATACL TASHTVSAED VTAEKSVERI AVTGSRIKRQ SATASPIQNI        60
     DLETLNANGS LSLGDALQEL PSVGSSLNGN GSAGSSHGSS SLNLRNLGAN RSLVLVNGHR       120
     WVNGAGSRGF RDFVDMNTIP QAIIKRVEVL QDGATAIYGA DAIAGVVNLY TYDDYEGLEV       180
     KTTYGETTKS DRETFNIDIL SGVNINDGNL MFAASHVDQK PIYTQDRNIT AVPLNGLTSA       240
     TPEGHFFEDN LATVNGLTPS SGGITRDPGK DGNNIDNWRK VNSDDTYNRY YNNYVTGPSE       300
     RSSLYTQLVM PIGSVNFKAE ALYNSRESDQ QFSPALSPIR GSRGFVIADD ARVNPFGVEF       360
     SGSDFKHNAF FMNNGYRVNE QKVETTRFAI GLDGELSNDW SWDSFASWAS NKGEFTSNNQ       420
     MNLDKLALGL RACDTTGIDA DVTDLVSGCV PVNIFAPLTD DMVNYINFTG HDKNEASQLD       480
     FTANITGSLY ELPAGYIGAA FGIEYRKEKG EDTPDSIINS DPRINTYRTT TSSPREGTIG       540
     EYDLKEAYAE FSIPLLDDKP LAEYLELSLA VRYSDYSTFG STTNSKVGLL YTPFEQLTLR       600
     ANWAEGFRAP SILELFEGER LTYKAVNDPC STDNNLAGCS GVPTDYSQPF SNVQVTTGGN       660
     RQLVPETSKN KTVGLIYESN LIENLSFTLD WYEIEINNTI SEFGAQNNLD LCAYQNKNCD       720
     TITRDSSGEI IDILDGPVNL NATRVSGIDF VSYYTLQTDF GDWSFNANVS KLNTLTEYST       780
     LSDGSIEQED LVGTAASRES YPEWRGTFSS TWKYNGWTAN YNLRHIDSTT EQFLGEPRGI       840
     GSVTYHNISG GYQFANNLSV KLGVNNLGDK QPPASLTNLN INFDQNTYNP VGRYMYLQLT       900
     YSL                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page