(data stored in ACNUC7421 zone)

EMBL: CR954246.PE413

CR954246.PE413       Location/Qualifiers
FT   CDS             448196..449044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0429"
FT                   /product="conserved protein of unknown function ; putative
FT                   N-formylglutamate amidohydrolase family"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85527"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH1"
FT                   /protein_id="CAI85527.1"
FT                   /translation="MKSAFSLLTPIESEEIPLVFDSPHSGIHCPDDFNAQVPLEFIKSG
FT                   WDAFIDDIWQPITEKGGYLLHANFSRMYIDPNRAPDDIDPALLDESWDRCKPTKYSDRG
FT                   MGLIRRYALPGKAMYDRKLTREEVTHRIDHYYSPYHTQLQTLLDDLYTRHQGVWHVDCH
FT                   SMKSVGNGMNIDAGIARPDIILGDKDGQSADPEFVNVIAQAFTHKGYKVVKNTPYKGGY
FT                   LVSNYGNVAANRHSVQIEVNRALYMNEKKFEKNENYEQFKRDTSFVAQQLAAYVSAQVG
FT                   K"
     MKSAFSLLTP IESEEIPLVF DSPHSGIHCP DDFNAQVPLE FIKSGWDAFI DDIWQPITEK        60
     GGYLLHANFS RMYIDPNRAP DDIDPALLDE SWDRCKPTKY SDRGMGLIRR YALPGKAMYD       120
     RKLTREEVTH RIDHYYSPYH TQLQTLLDDL YTRHQGVWHV DCHSMKSVGN GMNIDAGIAR       180
     PDIILGDKDG QSADPEFVNV IAQAFTHKGY KVVKNTPYKG GYLVSNYGNV AANRHSVQIE       240
     VNRALYMNEK KFEKNENYEQ FKRDTSFVAQ QLAAYVSAQV GK                          282
//

If you have problems or comments...

PBIL Back to PBIL home page