(data stored in ACNUC7421 zone)

EMBL: CR954246.PE414

CR954246.PE414       Location/Qualifiers
FT   CDS             449047..450438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0430"
FT                   /product="conserved protein of unknown function ; putative
FT                   C4-dicarboxylate anaerobic carrier family"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85528"
FT                   /db_xref="GOA:Q3IEH0"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH0"
FT                   /protein_id="CAI85528.1"
FT                   /translation="MSENNYSNEKKGLNPIIILLGILFLATLLTYIVDSGVYERDDNMV
FT                   VANSYNIIDKDKSLSNLFNYQDADLVKAEPVSIIGTFMAIPSGLEQGSGLIFMVLIIGG
FT                   MFGILTKAGTIDAGLERLLSLVQGNIYVLVILLMIVFSAGSTFLGLASEYLLIIPLMVG
FT                   MANRLGLPNIIGFAIVCVAVKAGYLSSVTNPLPLTIAQPLLGLQIFSGASVRFFFYLAF
FT                   LAVGIGFVLFMIKRQGFKNEQVHFHSEKLSTRHVIILLTLTSGIALLVYASTQWYWKHH
FT                   ALSAYYIALSMVLAAISGLSANQAAQAFVDGMKKVLLASILIGVATAVAVVLKQGMVLD
FT                   SIVHFLMSFIGEGNAYFAATGMFVSQLMLDFLIPSTSGQAAVSMPILGPIGNLAGVSEQ
FT                   TTIVAFLFGNGITNILTPTSGTLLAYLATARVGWGEWAKFIFPLWLIYIVLAIVLLQVS
FT                   VFINF"
     MSENNYSNEK KGLNPIIILL GILFLATLLT YIVDSGVYER DDNMVVANSY NIIDKDKSLS        60
     NLFNYQDADL VKAEPVSIIG TFMAIPSGLE QGSGLIFMVL IIGGMFGILT KAGTIDAGLE       120
     RLLSLVQGNI YVLVILLMIV FSAGSTFLGL ASEYLLIIPL MVGMANRLGL PNIIGFAIVC       180
     VAVKAGYLSS VTNPLPLTIA QPLLGLQIFS GASVRFFFYL AFLAVGIGFV LFMIKRQGFK       240
     NEQVHFHSEK LSTRHVIILL TLTSGIALLV YASTQWYWKH HALSAYYIAL SMVLAAISGL       300
     SANQAAQAFV DGMKKVLLAS ILIGVATAVA VVLKQGMVLD SIVHFLMSFI GEGNAYFAAT       360
     GMFVSQLMLD FLIPSTSGQA AVSMPILGPI GNLAGVSEQT TIVAFLFGNG ITNILTPTSG       420
     TLLAYLATAR VGWGEWAKFI FPLWLIYIVL AIVLLQVSVF INF                         463
//

If you have problems or comments...

PBIL Back to PBIL home page