(data stored in ACNUC7421 zone)

EMBL: CR954246.PE415

CR954246.PE415       Location/Qualifiers
FT   CDS             complement(450511..450633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0431"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85529"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEG9"
FT                   /protein_id="CAI85529.1"
FT                   /translation="MCSIYMLVKVSYESFVEEDLDKIVDLIFRLLQHGFKQLTD"
     MCSIYMLVKV SYESFVEEDL DKIVDLIFRL LQHGFKQLTD                              40
//

If you have problems or comments...

PBIL Back to PBIL home page