(data stored in ACNUC7421 zone)

EMBL: CR954246.PE416

CR954246.PE416       Location/Qualifiers
FT   CDS             450650..450826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0432"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85530"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEG8"
FT                   /protein_id="CAI85530.1"
FT                   /translation="MTANTQHCYFVIAEDDLGNESPASNERFAIVEAFDVMNPTVPMPF
FT                   SAEPTATIVLTVS"
     MTANTQHCYF VIAEDDLGNE SPASNERFAI VEAFDVMNPT VPMPFSAEPT ATIVLTVS          58
//

If you have problems or comments...

PBIL Back to PBIL home page