(data stored in ACNUC7421 zone)

EMBL: CR954246.PE418

CR954246.PE418       Location/Qualifiers
FT   CDS             451103..451309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0434"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85532"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS8"
FT                   /protein_id="CAI85532.1"
FT                   /translation="MTLKSIKSKNDFENAIKRFDELFNSAEPNTPEGDEFVLLSELIED
FT                   YELINVVLERKNQEEISVDLAEL"
     MTLKSIKSKN DFENAIKRFD ELFNSAEPNT PEGDEFVLLS ELIEDYELIN VVLERKNQEE        60
     ISVDLAEL                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page