(data stored in ACNUC7421 zone)

EMBL: CR954246.PE419

CR954246.PE419       Location/Qualifiers
FT   CDS             complement(451705..452718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0435"
FT                   /product="putative transcriptional regulator, AraC family"
FT                   /function="3.2.1.1 : Regulation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85533"
FT                   /db_xref="GOA:Q3IFS9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS9"
FT                   /protein_id="CAI85533.1"
FT                   /translation="MVRPYVTLNDKFIPVQGLVACLLELAQQRQLNQHKLLRGTGIFDE
FT                   DLLRPDFYLSLSQLLRLLKQFNNLMPGRDAAFQLGHRLFPASSAEASAILHSRNLTQAL
FT                   RLLSCFRLQLAPLLFAHHYKYNDYSYLQLNDAVGLDEQQYQFVVELYCCLLVSASRYML
FT                   GERIPFHFEFPFQRPRHIYEYEEHLGLKLTFGRPSLIVKFAQKWLTSPLLRSSQLHRKL
FT                   AMQQVNRDMLKQTFIEMISNYLHHHRQANLQQVSEHLNMSTATLKRRLKEHNLRFSQLQ
FT                   DRINMQLAFHFLTVQGLSNEVVAEKLAFHDAPNFRRACKRWTGLTPTELKALALSK"
     MVRPYVTLND KFIPVQGLVA CLLELAQQRQ LNQHKLLRGT GIFDEDLLRP DFYLSLSQLL        60
     RLLKQFNNLM PGRDAAFQLG HRLFPASSAE ASAILHSRNL TQALRLLSCF RLQLAPLLFA       120
     HHYKYNDYSY LQLNDAVGLD EQQYQFVVEL YCCLLVSASR YMLGERIPFH FEFPFQRPRH       180
     IYEYEEHLGL KLTFGRPSLI VKFAQKWLTS PLLRSSQLHR KLAMQQVNRD MLKQTFIEMI       240
     SNYLHHHRQA NLQQVSEHLN MSTATLKRRL KEHNLRFSQL QDRINMQLAF HFLTVQGLSN       300
     EVVAEKLAFH DAPNFRRACK RWTGLTPTEL KALALSK                                337
//

If you have problems or comments...

PBIL Back to PBIL home page