(data stored in ACNUC7421 zone)

EMBL: CR954246.PE420

CR954246.PE420       Location/Qualifiers
FT   CDS             complement(452694..453614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0436"
FT                   /product="conserved protein of unknown function ; putative
FT                   GGDEF domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85534"
FT                   /db_xref="GOA:Q3IFS7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS7"
FT                   /protein_id="CAI85534.1"
FT                   /translation="MNFTLLKLHPRMIVLTLSIIVLALLLCNMMGTTKLWQEIDWWDVL
FT                   GEGGIVLLTILWQFFLLLSRPPGRVTTLLTVGLCCFMFSGLLDFLDEFFRYPQEAWLPL
FT                   IENIPAPFGMILISRGLYLWYQEMLVLNAQLRRREANVREHQNVDSVTWLYRADYMHEQ
FT                   LRLQLEQGGRYCVAVVDIDQFDTFNRRFGHPEGDRLLREIAELILMNARLTDLVCRYAG
FT                   DRFILLMPQLALPQASLQVQQIASAVKHLAFKSGDMAVFHTLTTAVIEATKGESCQALL
FT                   RRLNTQFAQQKSDKAGVAWCDHMSR"
     MNFTLLKLHP RMIVLTLSII VLALLLCNMM GTTKLWQEID WWDVLGEGGI VLLTILWQFF        60
     LLLSRPPGRV TTLLTVGLCC FMFSGLLDFL DEFFRYPQEA WLPLIENIPA PFGMILISRG       120
     LYLWYQEMLV LNAQLRRREA NVREHQNVDS VTWLYRADYM HEQLRLQLEQ GGRYCVAVVD       180
     IDQFDTFNRR FGHPEGDRLL REIAELILMN ARLTDLVCRY AGDRFILLMP QLALPQASLQ       240
     VQQIASAVKH LAFKSGDMAV FHTLTTAVIE ATKGESCQAL LRRLNTQFAQ QKSDKAGVAW       300
     CDHMSR                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page