(data stored in ACNUC7421 zone)

EMBL: CR954246.PE421

CR954246.PE421       Location/Qualifiers
FT   CDS             453923..456631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0437"
FT                   /product="putative tonB-dependent receptor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85535"
FT                   /db_xref="GOA:Q3IFS6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS6"
FT                   /protein_id="CAI85535.1"
FT                   /translation="MKFKLSIISSACLAAMLSASAYAEPGNFVGTLSDGNKQVYFEGAQ
FT                   VKIKELNLTTQTRRDGTFRFNNIEPGHYTIEISYLGAAPIVKTIYIEENKTLKDQFTLT
FT                   ESGNTIEDIVVYGQRAGQAGALNMQRSADSIKSIVSSDAIGQFPDQNVAEALQRLPGLS
FT                   IERDQGEGRFVGIRGLDPNLNNVTVNGINIPSPEAGVRSVALDVFPSELVEGLEVSKSV
FT                   TSDMDADAIGGSVEIRSLSAFDRAGESASVTLQASHNQLRSDTSPKVSASYSNRYKFGN
FT                   VDDVFGVAAAVSWSDRDFGSDNIESNGDDEVEQRHYKINRERLGAALNLDYRPDFNNQY
FT                   YLRTLYSQFSDTEFRQANAFTFAGDDSEVERSSKDRFEEQQILSLTGGAEHQINQWLLT
FT                   YQAGYSKASEDEPEALNYVFKTDGFTLNSDLLGKIPHVEQQVGVSELANYKLDEIEFAN
FT                   NQSNDKEYSFRFDLAKDLTFLNYPSQIKFGSKYRSREKQQATQVTFFDGDFDNIDSDMF
FT                   VGGSPDWGLGEFGEGLNKHALRSFFNSNRANLEVAQLDSDIESRGESFINKEDILAAYI
FT                   MGTIDIEQLRIVAGFRYEKTQFSTSGHKVELIEDEYSDINQLDVNPWQVDRDYDYLLPS
FT                   LNVRYNVTENLISRFAYTQTLSRPKFEESAAFQIIESNTVKDSDGVLTTEREASVGNPE
FT                   LKPFESDNIDFTIEYYPGGIGVLSAGYFYKNISNFVIYADVANQPQWQGFDEVIQPING
FT                   DKATLQGIELAWVKTFENGLLLAANATFSDSEAVTLLDGKRFETSLPNQADRVGNLTVG
FT                   YEDEKWNLRLTMTHKSENLEEIDGELLRMEDSHQQLDFSSKYYINQKMNLYFNAINITD
FT                   QPFYNYFSERNRNAQYEEYGRTFELGFTWKM"
     MKFKLSIISS ACLAAMLSAS AYAEPGNFVG TLSDGNKQVY FEGAQVKIKE LNLTTQTRRD        60
     GTFRFNNIEP GHYTIEISYL GAAPIVKTIY IEENKTLKDQ FTLTESGNTI EDIVVYGQRA       120
     GQAGALNMQR SADSIKSIVS SDAIGQFPDQ NVAEALQRLP GLSIERDQGE GRFVGIRGLD       180
     PNLNNVTVNG INIPSPEAGV RSVALDVFPS ELVEGLEVSK SVTSDMDADA IGGSVEIRSL       240
     SAFDRAGESA SVTLQASHNQ LRSDTSPKVS ASYSNRYKFG NVDDVFGVAA AVSWSDRDFG       300
     SDNIESNGDD EVEQRHYKIN RERLGAALNL DYRPDFNNQY YLRTLYSQFS DTEFRQANAF       360
     TFAGDDSEVE RSSKDRFEEQ QILSLTGGAE HQINQWLLTY QAGYSKASED EPEALNYVFK       420
     TDGFTLNSDL LGKIPHVEQQ VGVSELANYK LDEIEFANNQ SNDKEYSFRF DLAKDLTFLN       480
     YPSQIKFGSK YRSREKQQAT QVTFFDGDFD NIDSDMFVGG SPDWGLGEFG EGLNKHALRS       540
     FFNSNRANLE VAQLDSDIES RGESFINKED ILAAYIMGTI DIEQLRIVAG FRYEKTQFST       600
     SGHKVELIED EYSDINQLDV NPWQVDRDYD YLLPSLNVRY NVTENLISRF AYTQTLSRPK       660
     FEESAAFQII ESNTVKDSDG VLTTEREASV GNPELKPFES DNIDFTIEYY PGGIGVLSAG       720
     YFYKNISNFV IYADVANQPQ WQGFDEVIQP INGDKATLQG IELAWVKTFE NGLLLAANAT       780
     FSDSEAVTLL DGKRFETSLP NQADRVGNLT VGYEDEKWNL RLTMTHKSEN LEEIDGELLR       840
     MEDSHQQLDF SSKYYINQKM NLYFNAINIT DQPFYNYFSE RNRNAQYEEY GRTFELGFTW       900
     KM                                                                      902
//

If you have problems or comments...

PBIL Back to PBIL home page