(data stored in ACNUC7421 zone)

EMBL: CR954246.PE422

CR954246.PE422       Location/Qualifiers
FT   CDS             456754..458682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0438"
FT                   /product="putative phytase domain protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85536"
FT                   /db_xref="GOA:Q3IFS5"
FT                   /db_xref="InterPro:IPR003431"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS5"
FT                   /protein_id="CAI85536.1"
FT                   /translation="MKYSLVTTLLCSLLPIMGCHAQKTTTTTVNINPLFSEPAFSGKQG
FT                   VMLSGEEPKWLLTSESKGLLLLDQQAQPLSRFNGNFETLTMRENVLLNEEQSTLIATID
FT                   NEHNTIKLLSLKQDNTFTLQSSLPFEHSQLESLCLFRQPLGDISLFAVDAVGEVHQFII
FT                   YNAKQQHIDIQPIRSFVGVPEVQGCAVDDSREQLYLVEGNIGVWQYDANPESDPMRTLI
FT                   VAANPFGQLQGDISDISVTAEGSVWITTPENQQLHVIQPITGLYQSITLDGLTEPETVN
FT                   VTLHNKRFQAVVFDAVQDSYWQVDDLKNIVPQKLLKTTTLATISADVQTDPVLRFGDAA
FT                   DDPAIWVDQQTPANSLILGTDKRVGLMVYGLDGALLQSLEIGRVNNVDVRQHSSINSPL
FT                   NTIITASNRTKSSISVFELDEQRSVHHVGEIATDLGDIYGLCMYQSDSGSYVFVNDKDG
FT                   RYQQYRISATKPNIVAKKVREFALPSQPEGCSADDRTGKLYMGEEDAGIWQIDAEPNPS
FT                   AQASRIADVGDILKDDVEGMEVYHGQNASYLVVSSQGNNSFVVYGLWDDYPILTNFRID
FT                   MDLTNGIDGVSETDGLTVSAAALPGYPQGVLIVQDGRNQLPQQPQNFKVVDWRKVQALI
FT                   EQSDHVN"
     MKYSLVTTLL CSLLPIMGCH AQKTTTTTVN INPLFSEPAF SGKQGVMLSG EEPKWLLTSE        60
     SKGLLLLDQQ AQPLSRFNGN FETLTMRENV LLNEEQSTLI ATIDNEHNTI KLLSLKQDNT       120
     FTLQSSLPFE HSQLESLCLF RQPLGDISLF AVDAVGEVHQ FIIYNAKQQH IDIQPIRSFV       180
     GVPEVQGCAV DDSREQLYLV EGNIGVWQYD ANPESDPMRT LIVAANPFGQ LQGDISDISV       240
     TAEGSVWITT PENQQLHVIQ PITGLYQSIT LDGLTEPETV NVTLHNKRFQ AVVFDAVQDS       300
     YWQVDDLKNI VPQKLLKTTT LATISADVQT DPVLRFGDAA DDPAIWVDQQ TPANSLILGT       360
     DKRVGLMVYG LDGALLQSLE IGRVNNVDVR QHSSINSPLN TIITASNRTK SSISVFELDE       420
     QRSVHHVGEI ATDLGDIYGL CMYQSDSGSY VFVNDKDGRY QQYRISATKP NIVAKKVREF       480
     ALPSQPEGCS ADDRTGKLYM GEEDAGIWQI DAEPNPSAQA SRIADVGDIL KDDVEGMEVY       540
     HGQNASYLVV SSQGNNSFVV YGLWDDYPIL TNFRIDMDLT NGIDGVSETD GLTVSAAALP       600
     GYPQGVLIVQ DGRNQLPQQP QNFKVVDWRK VQALIEQSDH VN                          642
//

If you have problems or comments...

PBIL Back to PBIL home page