(data stored in ACNUC7421 zone)

EMBL: CR954246.PE423

CR954246.PE423       Location/Qualifiers
FT   CDS             458833..459633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0439"
FT                   /product="conserved protein of unknown function ; putative
FT                   hydrolase activity(metallophosphoesterase)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85537"
FT                   /db_xref="GOA:Q3IFS4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR042281"
FT                   /db_xref="InterPro:IPR042283"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS4"
FT                   /protein_id="CAI85537.1"
FT                   /translation="MAGSSIRFAVLGDAEPKPVAEFPNLARAIDDVNRLASEKKIDFIL
FT                   GVGDIPHKGTMLQYNNVTPELQRLTLPFYPIMGNEEHGAEDAVTRFLHFANLWNKGKVT
FT                   IKSDKYTLEFDDFAIVLASPDHGRDFNSTGVNWILKQLKQLSPKPVLLVVHGAQQGVYP
FT                   ENPDKGISHEKFANVIAQPNLKAVISGDLHMDMDRVDHSKKIGKVHYLHIPALERTKIP
FT                   DETRHNPMYRVFNISPEGDVDVATYSVGNQHAIAEHSYQFSLNQ"
     MAGSSIRFAV LGDAEPKPVA EFPNLARAID DVNRLASEKK IDFILGVGDI PHKGTMLQYN        60
     NVTPELQRLT LPFYPIMGNE EHGAEDAVTR FLHFANLWNK GKVTIKSDKY TLEFDDFAIV       120
     LASPDHGRDF NSTGVNWILK QLKQLSPKPV LLVVHGAQQG VYPENPDKGI SHEKFANVIA       180
     QPNLKAVISG DLHMDMDRVD HSKKIGKVHY LHIPALERTK IPDETRHNPM YRVFNISPEG       240
     DVDVATYSVG NQHAIAEHSY QFSLNQ                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page