(data stored in ACNUC7421 zone)

EMBL: CR954246.PE424

CR954246.PE424       Location/Qualifiers
FT   CDS             complement(460427..460741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0441"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85538"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS3"
FT                   /protein_id="CAI85538.1"
FT                   /translation="MPQIPLNSVLLGLFIRAPVLALFISHISNRGQNWPFFIIKLHKIR
FT                   SLIINHLALNNHQTRLKLGKQLKYKIKNKLSVATIKPRDIINFISAYQVSILALCVDAF
FT                   "
     MPQIPLNSVL LGLFIRAPVL ALFISHISNR GQNWPFFIIK LHKIRSLIIN HLALNNHQTR        60
     LKLGKQLKYK IKNKLSVATI KPRDIINFIS AYQVSILALC VDAF                        104
//

If you have problems or comments...

PBIL Back to PBIL home page