(data stored in ACNUC7421 zone)

EMBL: CR954246.PE425

CR954246.PE425       Location/Qualifiers
FT   CDS             complement(460808..462103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0442"
FT                   /product="putative transport protein (MFS family)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85539"
FT                   /db_xref="GOA:Q3IEI7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI7"
FT                   /protein_id="CAI85539.1"
FT                   /translation="MAGVNIAIPNLAEDLNASAKMIAWMPTLYLLSSVMFMLPCGKIAD
FT                   NYGRKRVYASGLALNALASLMCALATSIEWVLFWRFIQGAAGAMIFGIGVAIITSVTPD
FT                   NKRGMALGTSAACVYIGLSAAPAMGGWLTEMWGWRAVFYSQIPLVLMLLITIKLFLQGE
FT                   WKNDKKSPFDWWGTVIFSLFALCLVLGLSDLPRMSGWLLTLLSITFLMLFIVHQSRSRR
FT                   PLIRVQMFLESRVFSLSLSTSFLMYASNFSLAFLLSLYLQYIKGLSPAHAGQIVLLQAV
FT                   SMAIMAPLAGKLADKIQPRLLATFGCIIVMIGFFLLSLLTVNSSTTYISGSLLLLGIGF
FT                   GLFSTPNNNAIMGAVDKSELGVASSSMNLSRTIGNLFGMSLINLIVQYYLGDSTFSAQN
FT                   SPALMSTISLAFKMSLGFVILASCISALRGRA"
     MAGVNIAIPN LAEDLNASAK MIAWMPTLYL LSSVMFMLPC GKIADNYGRK RVYASGLALN        60
     ALASLMCALA TSIEWVLFWR FIQGAAGAMI FGIGVAIITS VTPDNKRGMA LGTSAACVYI       120
     GLSAAPAMGG WLTEMWGWRA VFYSQIPLVL MLLITIKLFL QGEWKNDKKS PFDWWGTVIF       180
     SLFALCLVLG LSDLPRMSGW LLTLLSITFL MLFIVHQSRS RRPLIRVQMF LESRVFSLSL       240
     STSFLMYASN FSLAFLLSLY LQYIKGLSPA HAGQIVLLQA VSMAIMAPLA GKLADKIQPR       300
     LLATFGCIIV MIGFFLLSLL TVNSSTTYIS GSLLLLGIGF GLFSTPNNNA IMGAVDKSEL       360
     GVASSSMNLS RTIGNLFGMS LINLIVQYYL GDSTFSAQNS PALMSTISLA FKMSLGFVIL       420
     ASCISALRGR A                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page