(data stored in ACNUC7421 zone)

EMBL: CR954246.PE426

CR954246.PE426       Location/Qualifiers
FT   CDS             complement(462542..463966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0443"
FT                   /product="putative RNAse with metallo-beta-lactamase-like
FT                   domain"
FT                   /function="3.2.2 : Processing and degradation of RNA"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85540"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI6"
FT                   /protein_id="CAI85540.1"
FT                   /translation="MKILHHGAVNGVTGSCHELVINNSTSILIDCGLFQGEDSKTDLAI
FT                   GFDITNVTALIVTHCHIDHVGRIPYLLAAGFKGPIYTTKASASLLPLVIEDALKVGVTR
FT                   DPKIIAACLSLLAKRIVAVDFKTWFNLPINPSVNNAENTQTAKARFQRAGHILGSAYVE
FT                   IDIFENKSTKTTPNNTQGKSTHRVVFSGDLGAPYTPLLPTPKPPYKADTLVIESTYGDK
FT                   NHQGRKERTQTLKKVIEGAVADNGVVLVPAFSIGRTQELLYELEQLIHSAPKNSPWHSI
FT                   HVILDSPMAANFTEQYRNFKHLWDAEAKRKVAKGRHPLDFKNLTTIDTHKEHVAIISYL
FT                   ATRQTPAIILAASGMCTGGRIVNYLARFLSDKTTDILFVGYQGRGTLGHDIQTYGPRNG
FT                   YVFVNDTRIIINAKVHTISGYSAHADQNGLIKFVTGMRKKPNHIKIVHGDDDAKNALAN
FT                   KYREILGEKTFVEIAK"
     MKILHHGAVN GVTGSCHELV INNSTSILID CGLFQGEDSK TDLAIGFDIT NVTALIVTHC        60
     HIDHVGRIPY LLAAGFKGPI YTTKASASLL PLVIEDALKV GVTRDPKIIA ACLSLLAKRI       120
     VAVDFKTWFN LPINPSVNNA ENTQTAKARF QRAGHILGSA YVEIDIFENK STKTTPNNTQ       180
     GKSTHRVVFS GDLGAPYTPL LPTPKPPYKA DTLVIESTYG DKNHQGRKER TQTLKKVIEG       240
     AVADNGVVLV PAFSIGRTQE LLYELEQLIH SAPKNSPWHS IHVILDSPMA ANFTEQYRNF       300
     KHLWDAEAKR KVAKGRHPLD FKNLTTIDTH KEHVAIISYL ATRQTPAIIL AASGMCTGGR       360
     IVNYLARFLS DKTTDILFVG YQGRGTLGHD IQTYGPRNGY VFVNDTRIII NAKVHTISGY       420
     SAHADQNGLI KFVTGMRKKP NHIKIVHGDD DAKNALANKY REILGEKTFV EIAK             474
//

If you have problems or comments...

PBIL Back to PBIL home page