(data stored in ACNUC7421 zone)

EMBL: CR954246.PE431

CR954246.PE431       Location/Qualifiers
FT   CDS             468181..468531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0448"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85545"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI1"
FT                   /protein_id="CAI85545.1"
FT                   /translation="MMNFENLDVWKRSTRLSADIYKNPTLKKDFGFRDQLTRSGLSVPS
FT                   NIAEGMTRDSDKEKVRFLDIARSSLAEARTQIYIAIDINYIESDVGRAWLNETFELSKM
FT                   LTSLISKIKTRI"
     MMNFENLDVW KRSTRLSADI YKNPTLKKDF GFRDQLTRSG LSVPSNIAEG MTRDSDKEKV        60
     RFLDIARSSL AEARTQIYIA IDINYIESDV GRAWLNETFE LSKMLTSLIS KIKTRI           116
//

If you have problems or comments...

PBIL Back to PBIL home page