(data stored in ACNUC7421 zone)

EMBL: CR954246.PE433

CR954246.PE433       Location/Qualifiers
FT   CDS             complement(469248..470480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0450"
FT                   /product="conserved protein of unknown function ; putative
FT                   transmembrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85547"
FT                   /db_xref="GOA:Q3IEH9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH9"
FT                   /protein_id="CAI85547.1"
FT                   /translation="MILIKLAYKSLLNRRSSVLLTLLTIAISVMLLLSIERVRIDAKSS
FT                   FSNTISGTDLIVGARTGDIQLLLSSVFRIGHTNNGVSWQSYEYITGQRGVKWSIPISLG
FT                   DSHKGQAVLGTTLDYFNYYRFGKKQPLSFKQGHAFNTINQVVLGSGVASKLNYKLGDSI
FT                   VISHGMGSTSFHHHDDNPFKVVGILNATGTPVDKTLHIPLAAIDLIHGGHSEEHDEHSN
FT                   LVGHPKQITAFLMGFNSPLYTLQIRRNINQYKKEALLGIMPTVTLKELWEMLAIVEKIL
FT                   LLFSVVVVIISLLGMLTTLLANLNQRRRELAILRSVGARPWQLFTLISIESLLTTLLGC
FT                   IVGCVLFYALMFFGAGYLQSHAGISINIAMLSYYELTLIGVIMIAGFIIGLIPATRAYF
FT                   YSLSDGMSIKI"
     MILIKLAYKS LLNRRSSVLL TLLTIAISVM LLLSIERVRI DAKSSFSNTI SGTDLIVGAR        60
     TGDIQLLLSS VFRIGHTNNG VSWQSYEYIT GQRGVKWSIP ISLGDSHKGQ AVLGTTLDYF       120
     NYYRFGKKQP LSFKQGHAFN TINQVVLGSG VASKLNYKLG DSIVISHGMG STSFHHHDDN       180
     PFKVVGILNA TGTPVDKTLH IPLAAIDLIH GGHSEEHDEH SNLVGHPKQI TAFLMGFNSP       240
     LYTLQIRRNI NQYKKEALLG IMPTVTLKEL WEMLAIVEKI LLLFSVVVVI ISLLGMLTTL       300
     LANLNQRRRE LAILRSVGAR PWQLFTLISI ESLLTTLLGC IVGCVLFYAL MFFGAGYLQS       360
     HAGISINIAM LSYYELTLIG VIMIAGFIIG LIPATRAYFY SLSDGMSIKI                  410
//

If you have problems or comments...

PBIL Back to PBIL home page