(data stored in ACNUC7421 zone)

EMBL: CR954246.PE434

CR954246.PE434       Location/Qualifiers
FT   CDS             complement(470477..471163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0451"
FT                   /product="putative ABC transporter"
FT                   /function="1.2 : Transport/binding proteins and
FT                   lipoproteins"
FT                   /EC_number="3.6.3.30"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85548"
FT                   /db_xref="GOA:Q3IEH8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH8"
FT                   /protein_id="CAI85548.1"
FT                   /translation="MITISKLLFKWHKNAVSPTLNINQLNIKQGEHVFLHGPSGCGKST
FT                   LLALLAGINTATSGEVSILNKNLNSLSNTQRDVFRADHIGYIFQNFNLLPYLTPLENVS
FT                   LGCQFSKQRQQRALQQSNCLTAESARLLNALGLAQHLHHQDVGKLSIGQQQRVAAARAF
FT                   IGSPELIIADEPTSALDTNNRQSFIKLLFEQAKHANSTLVFVSHDESLQPLFNRSIDLV
FT                   NLQAAS"
     MITISKLLFK WHKNAVSPTL NINQLNIKQG EHVFLHGPSG CGKSTLLALL AGINTATSGE        60
     VSILNKNLNS LSNTQRDVFR ADHIGYIFQN FNLLPYLTPL ENVSLGCQFS KQRQQRALQQ       120
     SNCLTAESAR LLNALGLAQH LHHQDVGKLS IGQQQRVAAA RAFIGSPELI IADEPTSALD       180
     TNNRQSFIKL LFEQAKHANS TLVFVSHDES LQPLFNRSID LVNLQAAS                    228
//

If you have problems or comments...

PBIL Back to PBIL home page