(data stored in ACNUC7421 zone)

EMBL: CR954246.PE436

CR954246.PE436       Location/Qualifiers
FT   CDS             471804..473099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0453"
FT                   /product="conserved protein of unknown function ;putative
FT                   hipA protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 1715862, 8021189; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85550"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR5"
FT                   /protein_id="CAI85550.1"
FT                   /translation="MVFKPINKLEVKRTLSDSTELLVGVLAQNRQGVYFQFDQNYLDQY
FT                   SNLSPFSLSFNRDVQLAPKSPHNGLHGVFSDCLPDGWGSLLQDRVFRQNNIMPNFVTAM
FT                   DRLSFVGHSAMGALSFTPEANYNIPSEEEPGLAELGQQAQAIFDGQTETVLSALVAAGS
FT                   SGGARPKAQVYFPEHNIEECRTQPKIGDDAWLIKFTSKNLSLGHEEGLCEAVYLELADK
FT                   AKLSPPERLLVNAPEGTGAKQWLALKRFDRFKLPSNKMGRKQMHSACGLLDADFRAPTL
FT                   DYEDLIKASRVLCKSPAAGQLQFRRAIFNLFSCNQDDHSKNWAFLQEDSGEWNLAPFYD
FT                   VTFSPHPFNEHATSFAGYGKNPPIKAIQKLASAAGYANWKQVQIIISEIADIVFSFKDT
FT                   AKTFEVNKQTIQLIEQQLDNTYRINKQLCGSL"
     MVFKPINKLE VKRTLSDSTE LLVGVLAQNR QGVYFQFDQN YLDQYSNLSP FSLSFNRDVQ        60
     LAPKSPHNGL HGVFSDCLPD GWGSLLQDRV FRQNNIMPNF VTAMDRLSFV GHSAMGALSF       120
     TPEANYNIPS EEEPGLAELG QQAQAIFDGQ TETVLSALVA AGSSGGARPK AQVYFPEHNI       180
     EECRTQPKIG DDAWLIKFTS KNLSLGHEEG LCEAVYLELA DKAKLSPPER LLVNAPEGTG       240
     AKQWLALKRF DRFKLPSNKM GRKQMHSACG LLDADFRAPT LDYEDLIKAS RVLCKSPAAG       300
     QLQFRRAIFN LFSCNQDDHS KNWAFLQEDS GEWNLAPFYD VTFSPHPFNE HATSFAGYGK       360
     NPPIKAIQKL ASAAGYANWK QVQIIISEIA DIVFSFKDTA KTFEVNKQTI QLIEQQLDNT       420
     YRINKQLCGS L                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page