(data stored in ACNUC7421 zone)

EMBL: CR954246.PE438

CR954246.PE438       Location/Qualifiers
FT   CDS             474474..475151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0455"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85552"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR034242"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR3"
FT                   /protein_id="CAI85552.1"
FT                   /translation="MFERALQVFAKKRYLFALSVLFSHAAISANIDLVIKDQHGMVLPN
FT                   AVVEIGQANTAFKPTNPSVKKLPVAVMDQVNKQFLPELLIVQQGQLINFPNSDNIRHNV
FT                   YSFSSAKSFQLKLYSGQPKEPIIFDTQGVVVLGCNIHDSMVGYIYVAKSEQVYKTDKNG
FT                   VVSLPVTTQPLQISVWHALQTAPLENKKMMNIEPQAILPITINTSSPAPRNTFGSQFKG
FT                   GND"
     MFERALQVFA KKRYLFALSV LFSHAAISAN IDLVIKDQHG MVLPNAVVEI GQANTAFKPT        60
     NPSVKKLPVA VMDQVNKQFL PELLIVQQGQ LINFPNSDNI RHNVYSFSSA KSFQLKLYSG       120
     QPKEPIIFDT QGVVVLGCNI HDSMVGYIYV AKSEQVYKTD KNGVVSLPVT TQPLQISVWH       180
     ALQTAPLENK KMMNIEPQAI LPITINTSSP APRNTFGSQF KGGND                       225
//

If you have problems or comments...

PBIL Back to PBIL home page