(data stored in ACNUC7421 zone)

EMBL: CR954246.PE439

CR954246.PE439       Location/Qualifiers
FT   CDS             475144..477459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0456"
FT                   /product="putative HAMP domain/GGDEF domain/EAL domain
FT                   protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85553"
FT                   /db_xref="GOA:Q3IFR2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR2"
FT                   /protein_id="CAI85553.1"
FT                   /translation="MTNNLRNRITILCVGLVLLTTVVSLLSFWWSTSKFQEEKVNQDIS
FT                   VAQNVYKQYLNSKENLLLTAAKVLTSDFGFKQAVATRDAATISSVLYNHSQRINADLML
FT                   LLDLSGQLISTNDDEDNFTDNLQPLMSELLTTAERSSFVVLNGQLYQVILLPVKTPRTI
FT                   AYSLVGFKITSDVASELKSLTGMEVSFIASADSLVKTSLVAPPANLQPVNYFNSKTTSR
FT                   FFGDYLVYKNREIELPALQAHPVIILLSADLTQSYRDFEQLFITLIILAILTLIVGVVT
FT                   SSLLANNLTTPLSQLAVVAKQFAKGNYNFEFKGSKQSCEITTLMDAFHHMGSDINKREQ
FT                   QISYQARHDTLTGFYNRSAMLEMLAKQLNKSTEHTLVAIDIKGLRHINDKLGPRIGDDC
FT                   LKAVAKRISEFSDELGGFHARIGGDEFLTVFPAGAVSEFKRGIIALMAQLQASYTIQNL
FT                   KINLRFSVGVVQYPLHGEQAEDLIRRVLIAVDSATSHHQNIHYYQQGEDEAHLERLVML
FT                   DELKQAISDDDGQLFMTYQPKLNMKIQKVDKVESLIRWQRKDGSWVSPEVFIDLAEQSG
FT                   LIVELTAWVVNTVIAQVAAWQQKGIHLQAAINVSAQDIAFAGFHSSLVRTLKKHKVNPA
FT                   LITIELTERDMIENEEKGIIALENLKAIGVKISLDDYGVGQTSLGRLKMLPIDELKLDK
FT                   CFILKLDESQKDQFIVQSSITLGHQLGFSVVAEGVETVGTLTLLKQMQCDHAQGYYLSR
FT                   PLKAELLEQWLEEYDGVH"
     MTNNLRNRIT ILCVGLVLLT TVVSLLSFWW STSKFQEEKV NQDISVAQNV YKQYLNSKEN        60
     LLLTAAKVLT SDFGFKQAVA TRDAATISSV LYNHSQRINA DLMLLLDLSG QLISTNDDED       120
     NFTDNLQPLM SELLTTAERS SFVVLNGQLY QVILLPVKTP RTIAYSLVGF KITSDVASEL       180
     KSLTGMEVSF IASADSLVKT SLVAPPANLQ PVNYFNSKTT SRFFGDYLVY KNREIELPAL       240
     QAHPVIILLS ADLTQSYRDF EQLFITLIIL AILTLIVGVV TSSLLANNLT TPLSQLAVVA       300
     KQFAKGNYNF EFKGSKQSCE ITTLMDAFHH MGSDINKREQ QISYQARHDT LTGFYNRSAM       360
     LEMLAKQLNK STEHTLVAID IKGLRHINDK LGPRIGDDCL KAVAKRISEF SDELGGFHAR       420
     IGGDEFLTVF PAGAVSEFKR GIIALMAQLQ ASYTIQNLKI NLRFSVGVVQ YPLHGEQAED       480
     LIRRVLIAVD SATSHHQNIH YYQQGEDEAH LERLVMLDEL KQAISDDDGQ LFMTYQPKLN       540
     MKIQKVDKVE SLIRWQRKDG SWVSPEVFID LAEQSGLIVE LTAWVVNTVI AQVAAWQQKG       600
     IHLQAAINVS AQDIAFAGFH SSLVRTLKKH KVNPALITIE LTERDMIENE EKGIIALENL       660
     KAIGVKISLD DYGVGQTSLG RLKMLPIDEL KLDKCFILKL DESQKDQFIV QSSITLGHQL       720
     GFSVVAEGVE TVGTLTLLKQ MQCDHAQGYY LSRPLKAELL EQWLEEYDGV H                771
//

If you have problems or comments...

PBIL Back to PBIL home page