(data stored in ACNUC7421 zone)

EMBL: CR954246.PE440

CR954246.PE440       Location/Qualifiers
FT   CDS             477446..478279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0457"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85554"
FT                   /db_xref="InterPro:IPR021393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR1"
FT                   /protein_id="CAI85554.1"
FT                   /translation="MAYIKCFMAGVLLTASFIAAASSGKLLATPGVSQVEGAGGGGLVP
FT                   WAQLAGYASEDEVSVNGFCSRADVTDYTLDVCGAQLNLFNRVELSYAQQEFDVPALSTQ
FT                   IEQSITGAKVRLYGDIVYSSWPQVSLGMQHKSLDDGTVAKLVGAQSTSGTDFYLAASKL
FT                   HLGAIAGYNWFWNVTTRYSKANQLGLLGYGGNNASNKLLFEASTAIFLSREVALGVEYR
FT                   QKTNNLGLGEQDWKDVFVAWMPNKHMSVTAAYLDLGSIAGASDQTGWYLSVTGYW"
     MAYIKCFMAG VLLTASFIAA ASSGKLLATP GVSQVEGAGG GGLVPWAQLA GYASEDEVSV        60
     NGFCSRADVT DYTLDVCGAQ LNLFNRVELS YAQQEFDVPA LSTQIEQSIT GAKVRLYGDI       120
     VYSSWPQVSL GMQHKSLDDG TVAKLVGAQS TSGTDFYLAA SKLHLGAIAG YNWFWNVTTR       180
     YSKANQLGLL GYGGNNASNK LLFEASTAIF LSREVALGVE YRQKTNNLGL GEQDWKDVFV       240
     AWMPNKHMSV TAAYLDLGSI AGASDQTGWY LSVTGYW                                277
//

If you have problems or comments...

PBIL Back to PBIL home page