(data stored in ACNUC7421 zone)

EMBL: CR954246.PE441

CR954246.PE441       Location/Qualifiers
FT   CDS             478279..478698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0458"
FT                   /product="putative protozoan/cyanobacterial globin family
FT                   protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85555"
FT                   /db_xref="GOA:Q3IFR0"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR0"
FT                   /protein_id="CAI85555.1"
FT                   /translation="MRVFILFLLATSVLAGCSSKPKQSLYQQINGNAGIEKLVDSFIYQ
FT                   IGNDRQVFHYFEHSNITHFRQGFISHLCALTNGPCEYKGDSMVAIHTGMNINEKDFNHV
FT                   VDLLINAMDEQSIPHPVQNKIISKMAPLRSEIIKI"
     MRVFILFLLA TSVLAGCSSK PKQSLYQQIN GNAGIEKLVD SFIYQIGNDR QVFHYFEHSN        60
     ITHFRQGFIS HLCALTNGPC EYKGDSMVAI HTGMNINEKD FNHVVDLLIN AMDEQSIPHP       120
     VQNKIISKMA PLRSEIIKI                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page