(data stored in ACNUC7421 zone)

EMBL: CR954246.PE445

CR954246.PE445       Location/Qualifiers
FT   CDS             479990..480313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0462"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85559"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ6"
FT                   /protein_id="CAI85559.1"
FT                   /translation="MDIQKALAQFITFGSEKDEAIDVIVSAAAAKQPLFTLSTSIMLNV
FT                   FERCLHNEIVLDDLELWANVIEARDDIDCAECEGVIYALSNSEQMGELNYEKLAKLATL
FT                   LQE"
     MDIQKALAQF ITFGSEKDEA IDVIVSAAAA KQPLFTLSTS IMLNVFERCL HNEIVLDDLE        60
     LWANVIEARD DIDCAECEGV IYALSNSEQM GELNYEKLAK LATLLQE                     107
//

If you have problems or comments...

PBIL Back to PBIL home page