(data stored in ACNUC7421 zone)

EMBL: CR954246.PE447

CR954246.PE447       Location/Qualifiers
FT   CDS             481647..484076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0464"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85561"
FT                   /db_xref="GOA:Q3IFQ4"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR032534"
FT                   /db_xref="InterPro:IPR033413"
FT                   /db_xref="InterPro:IPR034032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ4"
FT                   /protein_id="CAI85561.1"
FT                   /translation="MQKIKLLGYILFTVLLTMITQAHAAIKSIDEFTGKMNHFPGYFSF
FT                   FYDTENGKVYLKVDKLEQQFLLQQSLPNGLGSNDIGLDRGQLGNTHLVQFERFGDKVML
FT                   RAVNTYYRANTSNKAEQQSINEAFASSILAGFKVVAQNKRALLIDYTPYLLSDVHGVNR
FT                   TLAATKQGNFNLDESRSAVYMSRSKAFINNTELEAVLTFAGTQPGKFVREISPDAYSLT
FT                   VHMHHSLIKLPDDNYTPRNFHPQSGFWSIEHKNYAAALGESMYVRYIPRHRLTKKDPSL
FT                   PISEPIEPIVYYLDPGVPEPVKSALLEGAQWWDEAFSAAGYKNAFIIKVLPTNADPMDI
FT                   RYNVVQWVHRATRGWSYGSSVIDPRTGEIIKGHVTLGSLRVRQDILIAEALAAPYLNGN
FT                   EIAKALQAMALDRIRQLSAHEIGHTLGISHNFAASVGDRASVMDYPHPLLSFDEQGKLD
FT                   VSRGYATGMGVWDTQVIKYGYSDFTNQNETAALAAILKENNTKGLEFISDSDARAAGGA
FT                   HPTAHLWDNGAAPSEELLRVLEVRKQALAQFGIHNIKTGEALSQLEEKLVPLYLFHRYQ
FT                   VEAVAKLIAGVNYKYEVRGDKPVKGAQVVAKPAQQQAVKAILTTLEGRNLVLPESILAL
FT                   IPPKAYGESRTRESIVGRTGLTLDAMALPEVAVQHSLSLLLNAQRLNRLAQQQARSDDF
FT                   YSLDELLLQLYKQVFVALPSNNMVAKITQRVQFLSAKTMADLVASDNVSPEVQAQLRYY
FT                   LTKLKDDFEQNSLLSNTSIGESAFKQYLAEQVNLFLTTGSWPDNFKALPIPPGSPI"
     MQKIKLLGYI LFTVLLTMIT QAHAAIKSID EFTGKMNHFP GYFSFFYDTE NGKVYLKVDK        60
     LEQQFLLQQS LPNGLGSNDI GLDRGQLGNT HLVQFERFGD KVMLRAVNTY YRANTSNKAE       120
     QQSINEAFAS SILAGFKVVA QNKRALLIDY TPYLLSDVHG VNRTLAATKQ GNFNLDESRS       180
     AVYMSRSKAF INNTELEAVL TFAGTQPGKF VREISPDAYS LTVHMHHSLI KLPDDNYTPR       240
     NFHPQSGFWS IEHKNYAAAL GESMYVRYIP RHRLTKKDPS LPISEPIEPI VYYLDPGVPE       300
     PVKSALLEGA QWWDEAFSAA GYKNAFIIKV LPTNADPMDI RYNVVQWVHR ATRGWSYGSS       360
     VIDPRTGEII KGHVTLGSLR VRQDILIAEA LAAPYLNGNE IAKALQAMAL DRIRQLSAHE       420
     IGHTLGISHN FAASVGDRAS VMDYPHPLLS FDEQGKLDVS RGYATGMGVW DTQVIKYGYS       480
     DFTNQNETAA LAAILKENNT KGLEFISDSD ARAAGGAHPT AHLWDNGAAP SEELLRVLEV       540
     RKQALAQFGI HNIKTGEALS QLEEKLVPLY LFHRYQVEAV AKLIAGVNYK YEVRGDKPVK       600
     GAQVVAKPAQ QQAVKAILTT LEGRNLVLPE SILALIPPKA YGESRTRESI VGRTGLTLDA       660
     MALPEVAVQH SLSLLLNAQR LNRLAQQQAR SDDFYSLDEL LLQLYKQVFV ALPSNNMVAK       720
     ITQRVQFLSA KTMADLVASD NVSPEVQAQL RYYLTKLKDD FEQNSLLSNT SIGESAFKQY       780
     LAEQVNLFLT TGSWPDNFKA LPIPPGSPI                                         809
//

If you have problems or comments...

PBIL Back to PBIL home page