(data stored in ACNUC7421 zone)

EMBL: CR954246.PE448

CR954246.PE448       Location/Qualifiers
FT   CDS             484287..485060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0465"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85562"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP2"
FT                   /protein_id="CAI85562.1"
FT                   /translation="MAFLSRSILALSVALLSNNVFAQKQCDVELRHGLIITDDIIRIVD
FT                   KGQTRVQINNNNQLFIRGYWIDLSDDESKVLEQFSSGIRQTVPELVNLATDGVNLGLSA
FT                   IEHVVEGMTDKESEVLKTQLQYVERALMDKFKRGDDFFFIAPQSLSKIDDFFTKDISKK
FT                   IHSAVHGSLGAILMSLGDAFKSREGNIEDRMNDMSQRMDIISSEIDKSLQEKARQLELK
FT                   AAEYCECLNALDVTESRLQAIVPGMVNFDLVQIKS"
     MAFLSRSILA LSVALLSNNV FAQKQCDVEL RHGLIITDDI IRIVDKGQTR VQINNNNQLF        60
     IRGYWIDLSD DESKVLEQFS SGIRQTVPEL VNLATDGVNL GLSAIEHVVE GMTDKESEVL       120
     KTQLQYVERA LMDKFKRGDD FFFIAPQSLS KIDDFFTKDI SKKIHSAVHG SLGAILMSLG       180
     DAFKSREGNI EDRMNDMSQR MDIISSEIDK SLQEKARQLE LKAAEYCECL NALDVTESRL       240
     QAIVPGMVNF DLVQIKS                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page