(data stored in ACNUC7421 zone)

EMBL: CR954246.PE45

CR954246.PE45        Location/Qualifiers
FT   CDS             49800..50390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0049"
FT                   /product="conserved protein of unknown function ; putative
FT                   methylase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85159"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF09"
FT                   /protein_id="CAI85159.1"
FT                   /translation="MIKPFSQACENNKQPILAQLKPVLANAKTVLEIGSGTGQHSVYFA
FT                   QQLPHLQWYSSDRAINHEGINLWHRDVNLTNLHVPLELDLNNAWPIDKVDAIYTANTFH
FT                   IVSWQLVEHFFAGVKQHLNDQGIVCIYGPFKYKGEFTSQSNNDFNRFLIERDPLSGIRD
FT                   FAAVELLAKQAGLTLISDIAMPANNQLLIFKRQ"
     MIKPFSQACE NNKQPILAQL KPVLANAKTV LEIGSGTGQH SVYFAQQLPH LQWYSSDRAI        60
     NHEGINLWHR DVNLTNLHVP LELDLNNAWP IDKVDAIYTA NTFHIVSWQL VEHFFAGVKQ       120
     HLNDQGIVCI YGPFKYKGEF TSQSNNDFNR FLIERDPLSG IRDFAAVELL AKQAGLTLIS       180
     DIAMPANNQL LIFKRQ                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page