(data stored in ACNUC7421 zone)

EMBL: CR954246.PE451

CR954246.PE451       Location/Qualifiers
FT   CDS             487172..488281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0468"
FT                   /product="conserved protein of unknown function ; putative
FT                   ATPase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85565"
FT                   /db_xref="GOA:Q3IFQ1"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ1"
FT                   /protein_id="CAI85565.1"
FT                   /translation="MTVQDTQIISLYQAKVASGELSFDAAQNNAVQALNSLSEQLQMHY
FT                   SWWQKSPLIKGVYLYGPVGRGKSMLMDLFYNNVAISKKQRLHFHHFIAQVHQQLGQLQG
FT                   QKDPLIIIAKNWAKNIRVLCFDEFFVSDIGDAMIMARLFDALFKQGVVLVATSNAKPEQ
FT                   LYYNGLQRARFLPTIDLINNYCEIVNVAGEEDHRFRYGKNSSHYFINLPSDDFKAKFLT
FT                   QYPQASHSGNITVHGRALPYLLKTANALMIDFMALCSGPRSANDYMFLAQQFSVLYVAN
FT                   VPKMGVGATGKVIVHGIEDSYQREKQTLDEHFFDDEARRFIALVDEFYDCHKLLVINAQ
FT                   ADIDTLYQGKKLSFEYARTQSRIVEMQNW"
     MTVQDTQIIS LYQAKVASGE LSFDAAQNNA VQALNSLSEQ LQMHYSWWQK SPLIKGVYLY        60
     GPVGRGKSML MDLFYNNVAI SKKQRLHFHH FIAQVHQQLG QLQGQKDPLI IIAKNWAKNI       120
     RVLCFDEFFV SDIGDAMIMA RLFDALFKQG VVLVATSNAK PEQLYYNGLQ RARFLPTIDL       180
     INNYCEIVNV AGEEDHRFRY GKNSSHYFIN LPSDDFKAKF LTQYPQASHS GNITVHGRAL       240
     PYLLKTANAL MIDFMALCSG PRSANDYMFL AQQFSVLYVA NVPKMGVGAT GKVIVHGIED       300
     SYQREKQTLD EHFFDDEARR FIALVDEFYD CHKLLVINAQ ADIDTLYQGK KLSFEYARTQ       360
     SRIVEMQNW                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page