(data stored in ACNUC7421 zone)

EMBL: CR954246.PE453

CR954246.PE453       Location/Qualifiers
FT   CDS             489751..490242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0470"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85567"
FT                   /db_xref="InterPro:IPR021557"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP9"
FT                   /protein_id="CAI85567.1"
FT                   /translation="MNPVNKIAMLMCFALPALAHAGESAIKWHDFKDYRDVRESNQGKA
FT                   SYHKHIASSIEEHVAKLAEQLPKDYKLSLEITDVDLAGDVRYGGINEIRVVKPIYFPQL
FT                   KLNYSLTNDKGEVISAASDVKLKDMGFMDKIKMGRDEPFNYEKRLLTEWFGEEILSKVD
FT                   "
     MNPVNKIAML MCFALPALAH AGESAIKWHD FKDYRDVRES NQGKASYHKH IASSIEEHVA        60
     KLAEQLPKDY KLSLEITDVD LAGDVRYGGI NEIRVVKPIY FPQLKLNYSL TNDKGEVISA       120
     ASDVKLKDMG FMDKIKMGRD EPFNYEKRLL TEWFGEEILS KVD                         163
//

If you have problems or comments...

PBIL Back to PBIL home page