(data stored in ACNUC7421 zone)

EMBL: CR954246.PE458

CR954246.PE458       Location/Qualifiers
FT   CDS             492680..493654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0475"
FT                   /product="putative fold recognizing lysyl-tRNA"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 5653192"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85572"
FT                   /db_xref="GOA:Q3IFP4"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFP4"
FT                   /protein_id="CAI85572.1"
FT                   /translation="MSVNLWAPSASIATLKQRAVILRSIREFFYARNVMEVETPSLSGA
FT                   SVTDIHLVSFNTRFVGPGHASGLELYLQTSPEFAMKRLLAAGSGPIFQLCKAFRNEEAG
FT                   SHHNPEFTMLEWYRPGFDEFALMAEIDELMQLILDVAPSERLTYQHAFEQVLGLDPLTA
FT                   SLEQLQQLACEQGFADIAKNETHRDTLLQLLFCMKVEPTIGQHKPCFVYHFPASQAALA
FT                   QICDHDSRVAGRFELYYKNMELANGFNELTNATEQAKRFNDDNEYRKQNGLKQVPMDKH
FT                   LIAALEHGLAPCAGVALGIDRLVMLATQKSNIKEVIAFDVTRA"
     MSVNLWAPSA SIATLKQRAV ILRSIREFFY ARNVMEVETP SLSGASVTDI HLVSFNTRFV        60
     GPGHASGLEL YLQTSPEFAM KRLLAAGSGP IFQLCKAFRN EEAGSHHNPE FTMLEWYRPG       120
     FDEFALMAEI DELMQLILDV APSERLTYQH AFEQVLGLDP LTASLEQLQQ LACEQGFADI       180
     AKNETHRDTL LQLLFCMKVE PTIGQHKPCF VYHFPASQAA LAQICDHDSR VAGRFELYYK       240
     NMELANGFNE LTNATEQAKR FNDDNEYRKQ NGLKQVPMDK HLIAALEHGL APCAGVALGI       300
     DRLVMLATQK SNIKEVIAFD VTRA                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page