(data stored in ACNUC7421 zone)

EMBL: CR954246.PE459

CR954246.PE459       Location/Qualifiers
FT   CDS             complement(493796..495895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0476"
FT                   /product="putative TonB-dependent receptor"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85573"
FT                   /db_xref="GOA:Q3IFP3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP3"
FT                   /protein_id="CAI85573.1"
FT                   /translation="MNLRLSLITAALLPLFGASVTANADDTDLERIVVTGDFQRESIQT
FT                   LSASASLFSEDEVNLRGATYLDEMLGSTANINFASGASRGRYIQIRGVGLRSQFVDPIN
FT                   PSVGLVIDGINYSGLGGSALLFDIDQVEIYRGPQGTRFGADGMAGMIQMQSAQATSDPS
FT                   LKLQVGAGTYNSREAGLAASTGLTDDTSARVSYFRRKSDGYVDNLYLNKPTQGQDEQVA
FT                   RFKLNSQITANLRTELNLHYIDINNGYDTFALDNGRNSVADEPGEDNQLSYAIGLNNTY
FT                   TGFDLFDVNLSLSAIDSELFYSFDEDWVCNDPSKPQLCAAGLHPDGYSSTDVYSRDRDD
FT                   QGVDLQFKSKTGNWVAGLYYQNRDVDLERQYTWLASPFNSTYETNNVAVYGQLATPIGP
FT                   KTTLITGLRVEQYQGDYTDNNGFIEDTDDIMVGGKIALEYQVIDRTMIYTSITRGYKAG
FT                   GINSEALAKAKDEGLNLDAEFFKQHTSFDPEYLWSGEFGVKGSSLDDKFILRLAAFYMH
FT                   RDNIQLKSWQVQDQKFTGYVDNASSGSNYGLELEGSYQLTDDLLITGSAGYLNTKINKF
FT                   VTKAGLNQDGRDQAQSPKYQYALSARYNLTNELYAMVGVEGKDDYYFSDSHNAQAPNSN
FT                   LVNVSLGYEADSWAVRAWARNVFDETVPTRGFEFGNNPLDGYADHTYTQLGEPRVAGVT
FT                   FTLNL"
     MNLRLSLITA ALLPLFGASV TANADDTDLE RIVVTGDFQR ESIQTLSASA SLFSEDEVNL        60
     RGATYLDEML GSTANINFAS GASRGRYIQI RGVGLRSQFV DPINPSVGLV IDGINYSGLG       120
     GSALLFDIDQ VEIYRGPQGT RFGADGMAGM IQMQSAQATS DPSLKLQVGA GTYNSREAGL       180
     AASTGLTDDT SARVSYFRRK SDGYVDNLYL NKPTQGQDEQ VARFKLNSQI TANLRTELNL       240
     HYIDINNGYD TFALDNGRNS VADEPGEDNQ LSYAIGLNNT YTGFDLFDVN LSLSAIDSEL       300
     FYSFDEDWVC NDPSKPQLCA AGLHPDGYSS TDVYSRDRDD QGVDLQFKSK TGNWVAGLYY       360
     QNRDVDLERQ YTWLASPFNS TYETNNVAVY GQLATPIGPK TTLITGLRVE QYQGDYTDNN       420
     GFIEDTDDIM VGGKIALEYQ VIDRTMIYTS ITRGYKAGGI NSEALAKAKD EGLNLDAEFF       480
     KQHTSFDPEY LWSGEFGVKG SSLDDKFILR LAAFYMHRDN IQLKSWQVQD QKFTGYVDNA       540
     SSGSNYGLEL EGSYQLTDDL LITGSAGYLN TKINKFVTKA GLNQDGRDQA QSPKYQYALS       600
     ARYNLTNELY AMVGVEGKDD YYFSDSHNAQ APNSNLVNVS LGYEADSWAV RAWARNVFDE       660
     TVPTRGFEFG NNPLDGYADH TYTQLGEPRV AGVTFTLNL                              699
//

If you have problems or comments...

PBIL Back to PBIL home page