(data stored in ACNUC7421 zone)

EMBL: CR954246.PE46

CR954246.PE46        Location/Qualifiers
FT   CDS             complement(50367..51506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0050"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85160"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF08"
FT                   /protein_id="CAI85160.1"
FT                   /translation="MATFSHQWFSSINQIERAHWQRLFGDEPFTQHAFLYALEQSQCVN
FT                   QQSGWQPYHLAIFEGENIIALAPGYLKSHSYGEYVFDWAWAEAYEKHGLEYYPKWLCGV
FT                   PFCPIEGSRIAIEHSNPSLVYKYITELLNLHSKEQGWSGWHVNFCNLAQATHLTEQHAM
FT                   LRVGVQFQWFNKGFTCFDDFLNTLNSRKRKSLKKERSKITQQNITIEWLQGMQITPEIM
FT                   QLFCEFYQRTYLKRSGHLGYLNMPFFKLLHALMADKLVIMLAKKEDAIIAATLSLIGAD
FT                   TLYGRYWGASEEVDSLHFELCYYQGIEFAIKHNLSCFHSGAQGEHKIARGFAPVLTYSA
FT                   HHIVDNNFSNAISDYLKRERQHINIYKDQCSALLPFKNQ"
     MATFSHQWFS SINQIERAHW QRLFGDEPFT QHAFLYALEQ SQCVNQQSGW QPYHLAIFEG        60
     ENIIALAPGY LKSHSYGEYV FDWAWAEAYE KHGLEYYPKW LCGVPFCPIE GSRIAIEHSN       120
     PSLVYKYITE LLNLHSKEQG WSGWHVNFCN LAQATHLTEQ HAMLRVGVQF QWFNKGFTCF       180
     DDFLNTLNSR KRKSLKKERS KITQQNITIE WLQGMQITPE IMQLFCEFYQ RTYLKRSGHL       240
     GYLNMPFFKL LHALMADKLV IMLAKKEDAI IAATLSLIGA DTLYGRYWGA SEEVDSLHFE       300
     LCYYQGIEFA IKHNLSCFHS GAQGEHKIAR GFAPVLTYSA HHIVDNNFSN AISDYLKRER       360
     QHINIYKDQC SALLPFKNQ                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page