(data stored in ACNUC7421 zone)

EMBL: CR954246.PE460

CR954246.PE460       Location/Qualifiers
FT   CDS             495998..496399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0477"
FT                   /product="conserved protein of unknown function ; putative
FT                   thioesterase superfamily"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85574"
FT                   /db_xref="GOA:Q3IFP1"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP1"
FT                   /protein_id="CAI85574.1"
FT                   /translation="MTFTVDFKVRDYECDLQGIVNNSVYFNYLEHARHEFLHAHGVDFA
FT                   QLAKDKINLVVMRSEMDYKQSLLPGDEFYVAVEPQRISRLKFAFKQTLIRKHDEKIMLN
FT                   ALVIGTALNEKGRPFLPAQIDNLFKTDSE"
     MTFTVDFKVR DYECDLQGIV NNSVYFNYLE HARHEFLHAH GVDFAQLAKD KINLVVMRSE        60
     MDYKQSLLPG DEFYVAVEPQ RISRLKFAFK QTLIRKHDEK IMLNALVIGT ALNEKGRPFL       120
     PAQIDNLFKT DSE                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page