(data stored in ACNUC7421 zone)

EMBL: CR954246.PE461

CR954246.PE461       Location/Qualifiers
FT   CDS             496544..496921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0478"
FT                   /product="putative heat shock protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8349564; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85575"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP0"
FT                   /protein_id="CAI85575.1"
FT                   /translation="MLIIGLCVGCASTQTVTSEQLKHTQWQLSRIDGLAIPPSFNASVG
FT                   FIEALQVNGFAGCNKFFGEGELDDSSLTVNKIGMTRKSCGQQLDKFEQQLLHALQQGAQ
FT                   LKMQDQQLVMQGEKTFVFIAK"
     MLIIGLCVGC ASTQTVTSEQ LKHTQWQLSR IDGLAIPPSF NASVGFIEAL QVNGFAGCNK        60
     FFGEGELDDS SLTVNKIGMT RKSCGQQLDK FEQQLLHALQ QGAQLKMQDQ QLVMQGEKTF       120
     VFIAK                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page