(data stored in ACNUC7421 zone)

EMBL: CR954246.PE469

CR954246.PE469       Location/Qualifiers
FT   CDS             complement(504739..505797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0487"
FT                   /product="putative GTPase engC precursor"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85583"
FT                   /db_xref="GOA:Q3IFN2"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFN2"
FT                   /protein_id="CAI85583.1"
FT                   /translation="MAKQKKLSKGQSRQIKANHQKRISSADARPAKKGAQEWQTDNLGQ
FT                   VESAIVISRFGQHADVEVESGEVLRCNIRRTVSNLVCGDEVLFRRAKVSEGDLAGVIEA
FT                   TQERRSQLTRPDFYDGVKVIAANIDQILMVSAVLPEFTPSIIDRYLIACEDMGIEPILV
FT                   LNKIDLIDAQGLSEIQKVLDVYRKLDYKVLLVSNISTDGIDELKDVLVGKNNIFVGQSG
FT                   VGKSTLVNTVLPDAEILTKEVSENSGLGQHTTTVSRLHHLPSGGNLIDSPGIREFGLWH
FT                   LEVDRVTWCFKEFREFIGGCRFRDCKHLNDPGCIIKEAVADGKISQLRFDSYHRILETM
FT                   ADGRAGSRAPRV"
     MAKQKKLSKG QSRQIKANHQ KRISSADARP AKKGAQEWQT DNLGQVESAI VISRFGQHAD        60
     VEVESGEVLR CNIRRTVSNL VCGDEVLFRR AKVSEGDLAG VIEATQERRS QLTRPDFYDG       120
     VKVIAANIDQ ILMVSAVLPE FTPSIIDRYL IACEDMGIEP ILVLNKIDLI DAQGLSEIQK       180
     VLDVYRKLDY KVLLVSNIST DGIDELKDVL VGKNNIFVGQ SGVGKSTLVN TVLPDAEILT       240
     KEVSENSGLG QHTTTVSRLH HLPSGGNLID SPGIREFGLW HLEVDRVTWC FKEFREFIGG       300
     CRFRDCKHLN DPGCIIKEAV ADGKISQLRF DSYHRILETM ADGRAGSRAP RV               352
//

If you have problems or comments...

PBIL Back to PBIL home page