(data stored in ACNUC7421 zone)

EMBL: CR954246.PE47

CR954246.PE47        Location/Qualifiers
FT   CDS             complement(51509..52879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0051"
FT                   /product="conserved protein of unknown function ; putative
FT                   secreted esterase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85161"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF07"
FT                   /protein_id="CAI85161.1"
FT                   /translation="MNNNSVFLKIFLTCMLSFLPHLAVAENCIAQASDFEFIKKSKQQG
FT                   LLRYTKDHHQAYFDYQARAPFNSYLNHAYQYISVANPRAAMPCPVFTQTYQQLVTQGSR
FT                   KPNPTIADIIAPFELKHSQSKKAVLLVHGLTDSPFTYHDLAQVYYQQGYTVRTILLPGH
FT                   GSAASALQDVDLQQWQQAVRYAIERTTQDFDEVILGGYSTGAALLIDYAITQALSSKIT
FT                   ALMLFSPGSEPHNKQGWIAKWLDLIPFLNWIDKDADVDFAKYESFPLNAAAASYDAMSL
FT                   VSIKNLSKRPALALPVFSVISDIDATIDSHATLKLLNALHNTNLSRYKKLDTLVLYGSS
FT                   TILPPNFAADYRVLNPQCASEACLKIHGISHIAIVNSPQNPHYGISASYRNCGSFIGGE
FT                   KLYKTCKTTKSPQLGERTAANLKQYPTLQRLTYNPFFPELKKQISTFIKNVEHAQGK"
     MNNNSVFLKI FLTCMLSFLP HLAVAENCIA QASDFEFIKK SKQQGLLRYT KDHHQAYFDY        60
     QARAPFNSYL NHAYQYISVA NPRAAMPCPV FTQTYQQLVT QGSRKPNPTI ADIIAPFELK       120
     HSQSKKAVLL VHGLTDSPFT YHDLAQVYYQ QGYTVRTILL PGHGSAASAL QDVDLQQWQQ       180
     AVRYAIERTT QDFDEVILGG YSTGAALLID YAITQALSSK ITALMLFSPG SEPHNKQGWI       240
     AKWLDLIPFL NWIDKDADVD FAKYESFPLN AAAASYDAMS LVSIKNLSKR PALALPVFSV       300
     ISDIDATIDS HATLKLLNAL HNTNLSRYKK LDTLVLYGSS TILPPNFAAD YRVLNPQCAS       360
     EACLKIHGIS HIAIVNSPQN PHYGISASYR NCGSFIGGEK LYKTCKTTKS PQLGERTAAN       420
     LKQYPTLQRL TYNPFFPELK KQISTFIKNV EHAQGK                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page