(data stored in ACNUC7421 zone)

EMBL: CR954246.PE472

CR954246.PE472       Location/Qualifiers
FT   CDS             complement(507477..507905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0491"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85586"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG95"
FT                   /protein_id="CAI85586.1"
FT                   /translation="MSWQQKAITLKPRIRGFHLIDDEILTQIPELTNYKVGLLHLFIQH
FT                   TSASLTINENADPTVRMDMESHFNEFVPQCQPYYRHDYEGDDDMPAHIKTSILGCELSI
FT                   PITNGYLALGTWQGVYLGEHRDNGGTRRIVATIQGELF"
     MSWQQKAITL KPRIRGFHLI DDEILTQIPE LTNYKVGLLH LFIQHTSASL TINENADPTV        60
     RMDMESHFNE FVPQCQPYYR HDYEGDDDMP AHIKTSILGC ELSIPITNGY LALGTWQGVY       120
     LGEHRDNGGT RRIVATIQGE LF                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page