(data stored in ACNUC7421 zone)

EMBL: CR954246.PE473

CR954246.PE473       Location/Qualifiers
FT   CDS             complement(507902..508369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0492"
FT                   /product="conserved protein of unknown function ; putative
FT                   CheC-like protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85587"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG94"
FT                   /protein_id="CAI85587.1"
FT                   /translation="MNVEFINPFLSSLINVLSTMAQTQLKPGKPRIKTDEKACGDVSGL
FT                   IGMVGPQTRGSFSITFDEQLALTIMERMLGERPDSINEEVTDMVGEITNMVTGGAKNLL
FT                   GQKGFDFDMATPIVVSGKDHTITHKSQGKKILMPFTCDAGNANIEVSFDKL"
     MNVEFINPFL SSLINVLSTM AQTQLKPGKP RIKTDEKACG DVSGLIGMVG PQTRGSFSIT        60
     FDEQLALTIM ERMLGERPDS INEEVTDMVG EITNMVTGGA KNLLGQKGFD FDMATPIVVS       120
     GKDHTITHKS QGKKILMPFT CDAGNANIEV SFDKL                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page