(data stored in ACNUC7421 zone)

EMBL: CR954246.PE48

CR954246.PE48        Location/Qualifiers
FT   CDS             complement(52869..55586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0052"
FT                   /product="hypothetical tryptophan-rich sensor protein"
FT                   /function="1.3 : Sensors (signal transduction)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85162"
FT                   /db_xref="GOA:Q3IF06"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF06"
FT                   /protein_id="CAI85162.1"
FT                   /translation="MKNFNSKYYSSVFYIIFSLAYFFVGVILTKLTFDSQIIPVWLPAG
FT                   IALVGCFVWWWRFIPALFLAALAFNLNFFANTTHEMVLVGNSLNEAMYIAFGVVLQAMV
FT                   GAAILKFWLGHPLRLKKRQNIIYFIVVVGVLVSLISANFGVFALSQFNAMYSADNHWKN
FT                   TTYWWLGDILGVLIATPFLLSLLPEKSDNYNISVLPTLSVCCILFVSVAATTQLYDSES
FT                   RINAIKIAEREVQVIENSLYRYTNRSIIAVQSLASQVQSSPTLSQQDFNQYANTLLAKH
FT                   SFIKALSWNVKIPSHQRQAFSKEISSIYNLNYDVIGEPLEPNDPLVIVKYIAPFNSNQK
FT                   AIGFNVYSNPDRKASLLNPAIKYQPVGTKIIQLVQTEHSDAAYLLFAPVYSQSNEKETI
FT                   KGYATGVFLVPQIIKQAITEQQSKMFSIAIYEDINKPAFYSNSNNLNVAQGSKLISFNV
FT                   DFGGQQWIVKLALKDAFLAQHNNQLTLLLLILQVVVCSLILLILLLFNQQQIALTRQVA
FT                   ERTYSLAQAKKQSDLANRAKSQFLANMSHEIRTPLNAVIGFSSLARKEDDANTLIDYLD
FT                   KINSSSKSLLNLINDILDISKIESKRLVLERIPFDLTALIQRINTMFEQSAASKAIVWK
FT                   INSNIPKDTWFVGDPMRLEQIMLNLCSNAIKFTNAGSVTLNVDTQLIAPNKAQLTIAVI
FT                   DTGIGIKATQHEKLFSAFTQADNSTSRQFGGTGLGLAIAKELSVLMNANIALHSELDKG
FT                   STFTFTLEIETVKAQDPLIKPTDNTNIAALKILVAEDNPVNQMVIKAMLGSLKIVPQVV
FT                   ENGELAVNIIKKQHFDLVFMDCQMPVMDGYRATALIRQFKTAEELPIVALTADVMPEDK
FT                   AHAQAVGFNQHLAKPLELIKLTECLAQYAVVYEQ"
     MKNFNSKYYS SVFYIIFSLA YFFVGVILTK LTFDSQIIPV WLPAGIALVG CFVWWWRFIP        60
     ALFLAALAFN LNFFANTTHE MVLVGNSLNE AMYIAFGVVL QAMVGAAILK FWLGHPLRLK       120
     KRQNIIYFIV VVGVLVSLIS ANFGVFALSQ FNAMYSADNH WKNTTYWWLG DILGVLIATP       180
     FLLSLLPEKS DNYNISVLPT LSVCCILFVS VAATTQLYDS ESRINAIKIA EREVQVIENS       240
     LYRYTNRSII AVQSLASQVQ SSPTLSQQDF NQYANTLLAK HSFIKALSWN VKIPSHQRQA       300
     FSKEISSIYN LNYDVIGEPL EPNDPLVIVK YIAPFNSNQK AIGFNVYSNP DRKASLLNPA       360
     IKYQPVGTKI IQLVQTEHSD AAYLLFAPVY SQSNEKETIK GYATGVFLVP QIIKQAITEQ       420
     QSKMFSIAIY EDINKPAFYS NSNNLNVAQG SKLISFNVDF GGQQWIVKLA LKDAFLAQHN       480
     NQLTLLLLIL QVVVCSLILL ILLLFNQQQI ALTRQVAERT YSLAQAKKQS DLANRAKSQF       540
     LANMSHEIRT PLNAVIGFSS LARKEDDANT LIDYLDKINS SSKSLLNLIN DILDISKIES       600
     KRLVLERIPF DLTALIQRIN TMFEQSAASK AIVWKINSNI PKDTWFVGDP MRLEQIMLNL       660
     CSNAIKFTNA GSVTLNVDTQ LIAPNKAQLT IAVIDTGIGI KATQHEKLFS AFTQADNSTS       720
     RQFGGTGLGL AIAKELSVLM NANIALHSEL DKGSTFTFTL EIETVKAQDP LIKPTDNTNI       780
     AALKILVAED NPVNQMVIKA MLGSLKIVPQ VVENGELAVN IIKKQHFDLV FMDCQMPVMD       840
     GYRATALIRQ FKTAEELPIV ALTADVMPED KAHAQAVGFN QHLAKPLELI KLTECLAQYA       900
     VVYEQ                                                                   905
//

If you have problems or comments...

PBIL Back to PBIL home page