(data stored in ACNUC7421 zone)

EMBL: CR954246.PE480

CR954246.PE480       Location/Qualifiers
FT   CDS             518289..519275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0504"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85594"
FT                   /db_xref="InterPro:IPR016936"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG87"
FT                   /protein_id="CAI85594.1"
FT                   /translation="MSQHKGKIVAALAILLIIFYAIAVYWSTEPARFNVVEKAKQQAQQ
FT                   RNEQFVIGYTTTSTLITVASTLLEKPGGYLSNDVLPPSIIMDDMPAWEYGALEMVRDLA
FT                   LSMRKDFSRSQSQSTEHEALKKAQPQFNISSEAWAWPSAEGEYQKGIDYLLVYRTQIAN
FT                   DHERDSQFYARADNLRSWLKEAEKRLGSLSQRLSASVGQDKVNTDLAGNTSNTQATFSP
FT                   LQQQAKTPWLDIDDVFYESRGATWALLHFLQAVEYDFADVLEKKNARVSVQQIIRELEA
FT                   TQETVWSPMILNGNGFGYVANHSLVMANYISRANAALIELSELLTQG"
     MSQHKGKIVA ALAILLIIFY AIAVYWSTEP ARFNVVEKAK QQAQQRNEQF VIGYTTTSTL        60
     ITVASTLLEK PGGYLSNDVL PPSIIMDDMP AWEYGALEMV RDLALSMRKD FSRSQSQSTE       120
     HEALKKAQPQ FNISSEAWAW PSAEGEYQKG IDYLLVYRTQ IANDHERDSQ FYARADNLRS       180
     WLKEAEKRLG SLSQRLSASV GQDKVNTDLA GNTSNTQATF SPLQQQAKTP WLDIDDVFYE       240
     SRGATWALLH FLQAVEYDFA DVLEKKNARV SVQQIIRELE ATQETVWSPM ILNGNGFGYV       300
     ANHSLVMANY ISRANAALIE LSELLTQG                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page