(data stored in ACNUC7421 zone)

EMBL: CR954246.PE481

CR954246.PE481       Location/Qualifiers
FT   CDS             519279..520049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0505"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85595"
FT                   /db_xref="InterPro:IPR026387"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG86"
FT                   /protein_id="CAI85595.1"
FT                   /translation="MKKYCLAAALSMACLAPAAQADTLLGLYVGVDGWKADNEGSFSYK
FT                   GNAPQDFNFDDETFVSYYAALEHPVPLVPNIKLRYTELELTGSTRLDKTFSFNGSDYVV
FT                   GTTVNSVSDLTHIDYTFYYEIFDNDLISIDLGVNAKQFDGEILVKGTTQQGGADYTETV
FT                   EFSGFVPLVYGRAEAGLPFTGLSVFFEGSFVAIDDSKVQDYQMGIAWEFIDNLAIDVAV
FT                   KAGYRSMTLELDDIDDINTNIDASGPFAGIQVHF"
     MKKYCLAAAL SMACLAPAAQ ADTLLGLYVG VDGWKADNEG SFSYKGNAPQ DFNFDDETFV        60
     SYYAALEHPV PLVPNIKLRY TELELTGSTR LDKTFSFNGS DYVVGTTVNS VSDLTHIDYT       120
     FYYEIFDNDL ISIDLGVNAK QFDGEILVKG TTQQGGADYT ETVEFSGFVP LVYGRAEAGL       180
     PFTGLSVFFE GSFVAIDDSK VQDYQMGIAW EFIDNLAIDV AVKAGYRSMT LELDDIDDIN       240
     TNIDASGPFA GIQVHF                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page