(data stored in ACNUC7421 zone)

EMBL: CR954246.PE482

CR954246.PE482       Location/Qualifiers
FT   CDS             complement(520086..520973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0506"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85596"
FT                   /db_xref="InterPro:IPR021254"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG85"
FT                   /protein_id="CAI85596.1"
FT                   /translation="MAVKTAQARINLANTIESLLGYPIIKVGNNEASHNNEQSYGPQGK
FT                   VKPLYRINSDNTVLARAQKRQDLLLIKQQQNIETILAMAMDFCPDVASSKQPDADWVEH
FT                   FVALCGDTSNQSMQSLWAKILTGETLNPGTFSIKSLQTLKHMTQREADSLQKCVSLSGY
FT                   NEKDDSHFILLGFYKKPSLFDLLRKGNKVSLNLGKTGISFPDILTLMDLNLLYRKEIES
FT                   AVLKTGQELTLSFLSQKVTLKAKNSDLVLSYYKFTQTGDELSKLINYPVNKVYKQLLNS
FT                   ALESEFELAWHTTK"
     MAVKTAQARI NLANTIESLL GYPIIKVGNN EASHNNEQSY GPQGKVKPLY RINSDNTVLA        60
     RAQKRQDLLL IKQQQNIETI LAMAMDFCPD VASSKQPDAD WVEHFVALCG DTSNQSMQSL       120
     WAKILTGETL NPGTFSIKSL QTLKHMTQRE ADSLQKCVSL SGYNEKDDSH FILLGFYKKP       180
     SLFDLLRKGN KVSLNLGKTG ISFPDILTLM DLNLLYRKEI ESAVLKTGQE LTLSFLSQKV       240
     TLKAKNSDLV LSYYKFTQTG DELSKLINYP VNKVYKQLLN SALESEFELA WHTTK            295
//

If you have problems or comments...

PBIL Back to PBIL home page